Clone GH27834 Report

Search the DGRC for GH27834

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:278
Well:34
Vector:pOT2
Associated Gene/TranscriptCG12159-RB
Protein status:GH27834.pep: gold
Preliminary Size:720
Sequenced Size:868

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12159 2002-01-01 Sim4 clustering to Release 2
CG12159 2002-05-18 Blastp of sequenced clone
CG12159 2003-01-01 Sim4 clustering to Release 3
CG12159 2008-04-29 Release 5.5 accounting
CG12159 2008-08-15 Release 5.9 accounting
CG12159 2008-12-18 5.12 accounting

Clone Sequence Records

GH27834.complete Sequence

868 bp (868 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118826

> GH27834.complete
CAACTCTGACGCCAAGCAAAACAAAAACAGTGCAGCAAAGAAATTTAAAA
GGTCATTGTTTATGCTTAGAAGCGGCTATATTTAGTAATTTTGATAGTTG
GATACGAAAAGATGTCCTGTCGCTGCTTCTGCTTAGTGGCTGCAGCACTG
CTGCTGCTGTTCTTCCACCAGCAATCCTGTGACGCAGCCACCCAGACGCC
CCAAAAGACGGTGGTAATTGCGGAGCAGAGTGCGCCGGCTGCTGAGGTGG
AGGCCAAAAAGCCAGTCGTGAAGAAATCGCAAGCAGAGAATCCTCCGGCA
GGACCAAAGGATTCTATGGTGGTCGTAGACGATGGCGGACCTGCTCCGGT
TGCTCCAGGTGCTTCGGTTGCCACACAAGTTTCACCAGGAGATGCCAAGG
CACCGGAAATGGTGCAGCCTCCGGGAGGTCTTCCCGTGGATGATGTTCAT
GTTGAACGCTCTCCCATGTCCCCCGATGTGGACTTTCCGGGCCAGGCTGT
TGTCTACATCCTCGTGGGAATCACCAGTACTGCAATACTGCTGCTTATTA
TGAGGGTTTATAGGCTCCGACTTTCCCGGGCGGAGCGCAAGTACGGCGTG
CAGGGCGACCGCGCCAACCAGGAGCTGACACCACTGCCCATGGCCATCGA
GGACGTGAATAGTGACGAAGAGGACCACACCCTGTTCGAGTTGGTTCAGG
TTTAACGAATCAAAAAGGAAAACAAAACCACTTGTGATAACGATTACGAT
GATATGTATGCAAGGCATTAAAAATCTCATAAATACCAATGCTTTCAAAT
CGCCTCTGCGTCGATGTTCCATATAAATAAATGTTATATTACATGTAAAA
AAAAAAAAAAAAAAAAAA

GH27834.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG12159-RB 983 CG12159-RB 138..983 1..846 4230 100 Plus
CG12159-RA 1182 CG12159-RA 138..827 1..690 3450 100 Plus
CG12159-RA 1182 CG12159-RA 1038..1182 689..833 725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3803274..3803837 564..1 2790 99.6 Minus
chr2R 21145070 chr2R 3802401..3802558 846..689 790 100 Minus
chr2R 21145070 chr2R 3802769..3802897 690..562 645 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:11:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7915900..7916463 564..1 2820 100 Minus
2R 25286936 2R 7915026..7915184 847..689 795 100 Minus
2R 25286936 2R 7915395..7915523 690..562 645 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7917099..7917662 564..1 2820 100 Minus
2R 25260384 2R 7916225..7916383 847..689 795 100 Minus
2R 25260384 2R 7916594..7916722 690..562 645 100 Minus
Blast to na_te.dros performed 2019-03-15 20:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 7450..7539 167..254 121 64.1 Plus

GH27834.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:34:05 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3802401..3802556 691..846 100 <- Minus
chr2R 3802769..3802895 564..690 100 <- Minus
chr2R 3803275..3803837 1..563 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:40 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
CG12159-RB 1..594 112..705 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:08:51 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
CG12159-RB 1..594 112..705 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:04 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
CG12159-RB 1..594 112..705 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:34 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
CG12159-RB 1..594 112..705 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:34 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
CG12159-RB 1..844 1..844 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:39 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
CG12159-RB 1..846 1..846 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:08:51 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
CG12159-RB 16..861 1..846 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:04 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
CG12159-RB 1..844 1..844 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:34 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
CG12159-RB 16..861 1..846 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:05 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7915027..7915182 691..846 100 <- Minus
2R 7915395..7915521 564..690 100 <- Minus
2R 7915901..7916463 1..563 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:05 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7915027..7915182 691..846 100 <- Minus
2R 7915395..7915521 564..690 100 <- Minus
2R 7915901..7916463 1..563 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:05 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7915027..7915182 691..846 100 <- Minus
2R 7915395..7915521 564..690 100 <- Minus
2R 7915901..7916463 1..563 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:08:51 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3802532..3802687 691..846 100 <- Minus
arm_2R 3802900..3803026 564..690 100 <- Minus
arm_2R 3803406..3803968 1..563 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:09 Download gff for GH27834.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7917100..7917662 1..563 100   Minus
2R 7916226..7916381 691..846 100 <- Minus
2R 7916594..7916720 564..690 100 <- Minus

GH27834.pep Sequence

Translation from 111 to 704

> GH27834.pep
MSCRCFCLVAAALLLLFFHQQSCDAATQTPQKTVVIAEQSAPAAEVEAKK
PVVKKSQAENPPAGPKDSMVVVDDGGPAPVAPGASVATQVSPGDAKAPEM
VQPPGGLPVDDVHVERSPMSPDVDFPGQAVVYILVGITSTAILLLIMRVY
RLRLSRAERKYGVQGDRANQELTPLPMAIEDVNSDEEDHTLFELVQV*

GH27834.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11234-PA 175 GF11234-PA 1..175 13..197 409 57.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10702-PA 187 GG10702-PA 1..187 1..197 677 76.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20586-PA 194 GH20586-PA 66..186 79..194 326 57.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG12159-PB 197 CG12159-PB 1..197 1..197 1004 100 Plus
CG12159-PA 202 CG12159-PA 1..194 1..194 988 99.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19733-PA 198 GI19733-PA 23..190 39..194 360 52.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10388-PA 203 GL10388-PA 1..195 1..194 418 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11444-PA 203 GA11444-PA 1..195 1..194 416 50.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20748-PA 203 GM20748-PA 1..195 1..194 864 91.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10214-PA 200 GD10214-PA 1..192 1..194 887 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18424-PA 195 GJ18424-PA 44..187 50..194 386 58.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21352-PA 209 GK21352-PA 99..201 82..194 352 61.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23552-PA 186 GE23552-PA 1..186 1..197 631 79.2 Plus

GH27834.hyp Sequence

Translation from 111 to 704

> GH27834.hyp
MSCRCFCLVAAALLLLFFHQQSCDAATQTPQKTVVIAEQSAPAAEVEAKK
PVVKKSQAENPPAGPKDSMVVVDDGGPAPVAPGASVATQVSPGDAKAPEM
VQPPGGLPVDDVHVERSPMSPDVDFPGQAVVYILVGITSTAILLLIMRVY
RLRLSRAERKYGVQGDRANQELTPLPMAIEDVNSDEEDHTLFELVQV*

GH27834.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG12159-PB 197 CG12159-PB 1..197 1..197 1004 100 Plus
CG12159-PA 202 CG12159-PA 1..194 1..194 988 99.5 Plus