Clone GH28004 Report

Search the DGRC for GH28004

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:280
Well:4
Vector:pOT2
Associated Gene/TranscriptCapa-RA
Protein status:GH28004.pep: gold
Preliminary Size:895
Sequenced Size:728

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15520 2001-01-01 Release 2 assignment
CG15520 2001-11-29 Blastp of sequenced clone
CG15520 2003-01-01 Sim4 clustering to Release 3
capa 2008-04-29 Release 5.5 accounting
capa 2008-08-15 Release 5.9 accounting
capa 2008-12-18 5.12 accounting

Clone Sequence Records

GH28004.complete Sequence

728 bp (728 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069234

> GH28004.complete
TTCCGAGGATAACATCAGACCGAAAAACATATTCGCCAAGCCAGTGTTTC
GTCCTAAATAGTCTTGCAAATATGAAATCTATGTTGGTCCACATAGTTCT
AGTGATTTTCATAATCGCCGAATTCAGTACAGCTGAGACGGACCACGACA
AGAACCGACGAGGTGCCAACATGGGGCTCTATGCCTTCCCGCGCGTTGGT
CGCAGCGATCCCAGTCTGGCCAACAGTCTGCGCGACGGATTAGAGGCCGG
AGTCCTCGACGGCATTTACGGAGATGCCTCCCAGGAGGATTACAATGAGG
CTGATTTCCAAAAGAAAGCCAGTGGTCTGGTGGCCTTCCCACGCGTTGGC
CGCGGTGACGCCGAGCTGAGGAAGTGGGCCCACCTTCTGGCTCTGCAACA
GGTGCTGGACAAGCGCACGGGACCCAGCGCCTCCTCGGGATTGTGGTTCG
GTCCCCGGCTGGGAAAGCGCAGTGTGGACGCCAAGTCGTTTGCGGACATC
TCCAAGGGACAGAAGGAACTCAACTAGACACACTGACTCCCCCTTTTGAC
ACTCTGAATGTCGTAGATACTTTTGTATATCAAAGAGAACGCTTCTAATT
GAATATTGTAACGGGTATACAGCAAATATGTTTTTCGGTCAAATATATAT
TATGAATAAGGGCTGGTGAGAGCTTGTAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH28004.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
capa-RA 778 capa-RA 38..716 1..679 3395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25735411..25735791 677..297 1845 99 Minus
chr3R 27901430 chr3R 25735861..25736023 297..135 815 100 Minus
chr3R 27901430 chr3R 25736614..25736748 135..1 675 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:11:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29912989..29913371 679..297 1915 100 Minus
3R 32079331 3R 29913441..29913603 297..135 815 100 Minus
3R 32079331 3R 29914194..29914328 135..1 675 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29653820..29654202 679..297 1915 100 Minus
3R 31820162 3R 29654272..29654434 297..135 815 100 Minus
3R 31820162 3R 29655025..29655159 135..1 675 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:44:38 has no hits.

GH28004.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:45:20 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25735411..25735790 298..677 98 <- Minus
chr3R 25735861..25736022 136..297 100 <- Minus
chr3R 25736614..25736748 1..135 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:59:26 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
capa-RA 1..456 72..527 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:38:12 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
capa-RA 1..456 72..527 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:57:18 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
capa-RA 1..456 72..527 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:54:35 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
capa-RA 1..456 72..527 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:02:09 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
Capa-RA 1..456 72..527 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:03:51 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
capa-RA 1..677 1..677 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:38:12 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
capa-RA 1..677 1..677 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:57:18 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
capa-RA 19..695 1..677 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:54:35 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
capa-RA 1..677 1..677 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:02:09 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
Capa-RA 19..695 1..677 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:45:20 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29912991..29913370 298..677 100 <- Minus
3R 29913441..29913602 136..297 100 <- Minus
3R 29914194..29914328 1..135 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:45:20 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29912991..29913370 298..677 100 <- Minus
3R 29913441..29913602 136..297 100 <- Minus
3R 29914194..29914328 1..135 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:45:20 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29912991..29913370 298..677 100 <- Minus
3R 29913441..29913602 136..297 100 <- Minus
3R 29914194..29914328 1..135 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:57:18 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25738713..25739092 298..677 100 <- Minus
arm_3R 25739163..25739324 136..297 100 <- Minus
arm_3R 25739916..25740050 1..135 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:02:28 Download gff for GH28004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29653822..29654201 298..677 100 <- Minus
3R 29654272..29654433 136..297 100 <- Minus
3R 29655025..29655159 1..135 100   Minus

GH28004.hyp Sequence

Translation from 2 to 526

> GH28004.hyp
PRITSDRKTYSPSQCFVLNSLANMKSMLVHIVLVIFIIAEFSTAETDHDK
NRRGANMGLYAFPRVGRSDPSLANSLRDGLEAGVLDGIYGDASQEDYNEA
DFQKKASGLVAFPRVGRGDAELRKWAHLLALQQVLDKRTGPSASSGLWFG
PRLGKRSVDAKSFADISKGQKELN*

GH28004.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Capa-PA 151 CG15520-PA 1..151 24..174 771 100 Plus

GH28004.pep Sequence

Translation from 71 to 526

> GH28004.pep
MKSMLVHIVLVIFIIAEFSTAETDHDKNRRGANMGLYAFPRVGRSDPSLA
NSLRDGLEAGVLDGIYGDASQEDYNEADFQKKASGLVAFPRVGRGDAELR
KWAHLLALQQVLDKRTGPSASSGLWFGPRLGKRSVDAKSFADISKGQKEL
N*

GH28004.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16224-PA 153 GF16224-PA 8..153 3..151 630 81.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11989-PA 151 GG11989-PA 1..151 1..151 761 96 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16817-PA 158 GH16817-PA 1..157 1..150 466 60.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Capa-PA 151 CG15520-PA 1..151 1..151 771 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10449-PA 155 GI10449-PA 1..154 1..150 499 63.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13502-PA 155 GL13502-PA 10..155 5..151 640 81.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13779-PA 155 GA13779-PA 10..155 5..151 640 81.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12207-PA 151 GM12207-PA 1..151 1..151 776 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17586-PA 151 GD17586-PA 1..151 1..151 779 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10666-PA 154 GJ10666-PA 1..153 1..150 477 63.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14094-PA 154 GK14094-PA 10..154 5..151 497 66.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10414-PA 151 GE10414-PA 1..151 1..151 775 98 Plus