Clone GH28351 Report

Search the DGRC for GH28351

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:283
Well:51
Vector:pOT2
Associated Gene/TranscriptCG10298-RA
Protein status:GH28351.pep: gold
Preliminary Size:902
Sequenced Size:739

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10298 2002-01-01 Sim4 clustering to Release 2
CG10298 2002-04-26 Blastp of sequenced clone
CG10298 2003-01-01 Sim4 clustering to Release 3
CG10298 2008-04-29 Release 5.5 accounting
CG10298 2008-08-15 Release 5.9 accounting
CG10298 2008-12-18 5.12 accounting

Clone Sequence Records

GH28351.complete Sequence

739 bp (739 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113352

> GH28351.complete
TTGTTGCCCACTCAGCTAAAAATGTCCGATTCCACCGTGTGCTTCTCTAA
GCACAAGATCGTGCCGGATATCCTGAAGACGTGTCCTGCCACTTTGCTTA
CGGTGACTTATGGTGGTGGACAGGTGGTGGATGTAGGCGGTGAATTGACA
CCCACGCAAGTGCAGAGCCAGCCAAAGGTGAAATGGGATGCAGATCCGAA
TGCCTTTTACACGCTCCTCCTGACCGATCCGGATGCGCCCAGTCGCAAGG
AGCCCAAGTTCCGCGAGTGGCACCACTGGCTGGTGGTCAATATTCCAGGG
AACCAAGTCGAGAACGGCGTAGTTTTGACCGAATATGTGGGTGCAGGTCC
GCCGCAAGGCACGGGGCTTCATCGTTACGTCTTCCTGGTCTTCAAACAGC
CCCAAAAGCTCACTTGCAACGAGCCCAAAATCCCAAAAACGAGCGGCGAC
AAGCGAGCCAATTTCAGCACCTCCAAGTTCATGAGCAAGTACAAGCTGGG
AGATCCCATTGCCGGAAACTTTTTTCAGGCACAGTGGGACGACTATGTGC
CCAAGTTATACAAGCAACTATCTGGCAAGAAGTAGTATCTTTCTCCTCAT
AATTAGGCTCCCAAATCCCTACAAAGCATGCTGTAAAGAAAAAGAATCAT
GTAAAAACAGATAAATTTCTAAATATCTATAATATATATTTAAAAAATAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH28351.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG10298-RA 770 CG10298-RA 73..770 1..698 3490 100 Plus
CG6180.a 991 CG6180.a 480..562 208..290 265 87.9 Plus
CG6180-RA 1024 CG6180-RA 513..595 208..290 265 87.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2168880..2169476 102..698 2970 99.8 Plus
chr3R 27901430 chr3R 2168726..2168829 1..104 520 100 Plus
chr2L 23010047 chr2L 12706874..12707057 208..391 275 76.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:11:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6343203..6343800 102..699 2990 100 Plus
3R 32079331 3R 6343049..6343152 1..104 520 100 Plus
2L 23513712 2L 12708173..12708356 208..391 275 76.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6084034..6084631 102..699 2990 100 Plus
3R 31820162 3R 6083880..6083983 1..104 520 100 Plus
2L 23513712 2L 12708173..12708255 208..290 265 87.9 Plus
3R 31820162 3R 6085467..6085527 208..268 155 83.6 Plus
Blast to na_te.dros performed on 2019-03-15 11:43:09 has no hits.

GH28351.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:44:08 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2168726..2168827 1..102 100 -> Plus
chr3R 2168881..2169437 103..659 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:59:40 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 1..564 22..585 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:19 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 1..564 22..585 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:32:19 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 1..564 22..585 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:38 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 1..564 22..585 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:40:55 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 1..564 22..585 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:37:10 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 48..745 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:19 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 48..745 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:32:19 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 48..745 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:39 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 48..745 1..698 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:40:55 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
CG10298-RA 48..745 1..698 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:08 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6343049..6343150 1..102 100 -> Plus
3R 6343204..6343799 103..698 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:08 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6343049..6343150 1..102 100 -> Plus
3R 6343204..6343799 103..698 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:08 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6343049..6343150 1..102 100 -> Plus
3R 6343204..6343799 103..698 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:32:19 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2168771..2168872 1..102 100 -> Plus
arm_3R 2168926..2169521 103..698 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:34 Download gff for GH28351.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6084035..6084630 103..698 100   Plus
3R 6083880..6083981 1..102 100 -> Plus

GH28351.hyp Sequence

Translation from 0 to 584

> GH28351.hyp
LLPTQLKMSDSTVCFSKHKIVPDILKTCPATLLTVTYGGGQVVDVGGELT
PTQVQSQPKVKWDADPNAFYTLLLTDPDAPSRKEPKFREWHHWLVVNIPG
NQVENGVVLTEYVGAGPPQGTGLHRYVFLVFKQPQKLTCNEPKIPKTSGD
KRANFSTSKFMSKYKLGDPIAGNFFQAQWDDYVPKLYKQLSGKK*

GH28351.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG10298-PA 187 CG10298-PA 1..187 8..194 1016 100 Plus
CG6180-PA 257 CG6180-PA 82..255 17..190 572 59.8 Plus
CG17919-PA 202 CG17919-PA 24..200 15..191 564 57.6 Plus
Pebp1-PA 176 CG18594-PA 6..171 20..186 525 58.7 Plus
a5-PA 210 CG5430-PA 34..207 19..192 448 43.7 Plus

GH28351.pep Sequence

Translation from 21 to 584

> GH28351.pep
MSDSTVCFSKHKIVPDILKTCPATLLTVTYGGGQVVDVGGELTPTQVQSQ
PKVKWDADPNAFYTLLLTDPDAPSRKEPKFREWHHWLVVNIPGNQVENGV
VLTEYVGAGPPQGTGLHRYVFLVFKQPQKLTCNEPKIPKTSGDKRANFST
SKFMSKYKLGDPIAGNFFQAQWDDYVPKLYKQLSGKK*

GH28351.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16395-PA 186 GF16395-PA 1..186 1..186 836 80.6 Plus
Dana\GF16396-PA 202 GF16396-PA 23..200 7..184 556 55.6 Plus
Dana\GF14208-PA 260 GF14208-PA 83..260 8..185 552 56.2 Plus
Dana\GF23379-PA 176 GF23379-PA 6..175 13..183 502 55 Plus
Dana\GF23378-PA 175 GF23378-PA 4..175 13..185 463 52.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13336-PA 187 GG13336-PA 1..187 1..187 950 93.6 Plus
Dere\GG13347-PA 202 GG13347-PA 23..200 7..184 571 57.9 Plus
Dere\GG23796-PA 178 GG23796-PA 1..178 8..185 568 59 Plus
Dere\GG11139-PA 176 GG11139-PA 6..175 13..183 529 57.3 Plus
Dere\GG24786-PA 210 GG24786-PA 24..207 2..185 445 42.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14039-PA 186 GH14039-PA 1..186 1..186 753 71.5 Plus
Dgri\GH13213-PA 178 GH13213-PA 1..178 8..185 574 59 Plus
Dgri\GH14040-PA 202 GH14040-PA 23..200 7..184 536 53.9 Plus
Dgri\GH22236-PA 176 GH22236-PA 6..175 13..183 521 56.7 Plus
Dgri\GH22229-PA 177 GH22229-PA 4..177 13..185 459 51.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG10298-PA 187 CG10298-PA 1..187 1..187 1016 100 Plus
CG6180-PA 257 CG6180-PA 82..255 10..183 572 59.8 Plus
CG17919-PA 202 CG17919-PA 24..200 8..184 564 57.6 Plus
Pebp1-PA 176 CG18594-PA 6..171 13..179 525 58.7 Plus
a5-PA 210 CG5430-PA 34..207 12..185 448 43.7 Plus
CG7054-PA 179 CG7054-PA 4..179 13..185 422 48.6 Plus
CG17917-PA 211 CG17917-PA 31..202 13..184 413 44.8 Plus
CG30060-PA 202 CG30060-PA 20..179 10..172 245 31.9 Plus
mRpL38-PA 416 CG15871-PA 165..317 39..180 172 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24413-PA 183 GI24413-PA 5..183 8..186 754 74.3 Plus
Dmoj\GI14504-PA 178 GI14504-PA 1..178 8..185 579 57.9 Plus
Dmoj\GI21978-PA 177 GI21978-PA 6..175 13..183 531 57.9 Plus
Dmoj\GI24414-PA 202 GI24414-PA 21..201 5..185 495 50.3 Plus
Dmoj\GI21977-PA 179 GI21977-PA 4..179 13..185 463 50.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24078-PA 189 GL24078-PA 4..189 2..187 764 73.7 Plus
Dper\GL24079-PA 203 GL24079-PA 24..201 7..184 580 58.4 Plus
Dper\GL19726-PA 256 GL19726-PA 84..256 13..185 561 59.5 Plus
Dper\GL24219-PA 179 GL24219-PA 4..179 13..185 473 52 Plus
Dper\GL24075-PA 220 GL24075-PA 29..206 8..184 419 45.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10227-PA 189 GA10227-PA 4..189 2..187 764 73.7 Plus
Dpse\GA14724-PA 203 GA14724-PA 24..201 7..184 580 58.4 Plus
Dpse\GA19416-PA 256 GA19416-PA 84..256 13..185 561 59.5 Plus
Dpse\GA15006-PA 176 GA15006-PA 6..175 13..183 500 53.2 Plus
Dpse\GA20063-PA 179 GA20063-PA 4..179 13..185 471 52 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10886-PA 187 GM10886-PA 1..187 1..187 973 97.3 Plus
Dsec\GM10048-PA 178 GM10048-PA 1..178 8..185 566 58.4 Plus
Dsec\GM10887-PA 202 GM10887-PA 23..200 7..184 564 56.7 Plus
Dsec\GM26437-PA 176 GM26437-PA 6..175 13..183 531 57.3 Plus
Dsec\GM16814-PA 210 GM16814-PA 29..207 7..185 449 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19865-PA 187 GD19865-PA 1..187 1..187 981 97.9 Plus
Dsim\GD23851-PA 178 GD23851-PA 1..178 8..185 566 58.4 Plus
Dsim\GD19866-PA 202 GD19866-PA 23..200 7..184 562 56.7 Plus
Dsim\GD20954-PA 176 GD20954-PA 6..175 13..183 529 57.3 Plus
Dsim\GD23094-PA 210 GD23094-PA 29..207 7..185 446 41.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14271-PA 186 GJ14271-PA 1..186 1..186 763 72 Plus
Dvir\GJ16279-PA 226 GJ16279-PA 49..224 8..183 587 59.1 Plus
Dvir\GJ14338-PA 176 GJ14338-PA 6..175 13..183 517 56.1 Plus
Dvir\GJ14272-PA 200 GJ14272-PA 22..198 7..183 514 52 Plus
Dvir\GJ14337-PA 179 GJ14337-PA 2..179 11..185 473 51.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13055-PA 191 GK13055-PA 11..191 7..187 683 68.5 Plus
Dwil\GK14662-PA 256 GK14662-PA 71..254 2..183 592 57.6 Plus
Dwil\GK13056-PA 202 GK13056-PA 22..200 7..184 555 56.4 Plus
Dwil\GK11699-PA 174 GK11699-PA 6..173 13..183 534 56.7 Plus
Dwil\GK11701-PA 180 GK11701-PA 6..175 13..183 529 56.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10210-PA 187 GE10210-PA 1..187 1..187 946 93 Plus
Dyak\GE10211-PA 202 GE10211-PA 23..200 7..184 577 57.9 Plus
Dyak\GE18600-PA 178 GE18600-PA 1..178 8..185 568 58.4 Plus
Dyak\GE10305-PA 176 GE10305-PA 6..175 13..183 535 57.9 Plus
Dyak\GE10304-PA 179 GE10304-PA 4..179 13..185 443 49.7 Plus