Clone GH28416 Report

Search the DGRC for GH28416

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:284
Well:16
Vector:pOT2
Associated Gene/TranscriptPglym87-RA
Protein status:GH28416.pep: gold
Preliminary Size:1216
Sequenced Size:1140

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17645 2001-01-01 Release 2 assignment
CG17645 2002-06-12 Blastp of sequenced clone
CG17645 2003-01-01 Sim4 clustering to Release 3
Pglym87 2008-04-29 Release 5.5 accounting
Pglym87 2008-08-15 Release 5.9 accounting
Pglym87 2008-12-18 5.12 accounting

Clone Sequence Records

GH28416.complete Sequence

1140 bp (1140 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122135

> GH28416.complete
AAATGAACACGATATAGACTGCAAACACTTTCCAAATTCAAAGTGTCCCA
AAATGTTGGCTCTGGCCAGGAATTCGTGGTGTGGCCAATTGCTGTGTCGC
GTGGCGAACATCGAAGCCCGCTGCCCGTTCTCGAAGTCATCATCCGGCGG
AAAGCAGGCCGAGAAGAAGGGCAAGTACAGGATTGTGATGGTTCGTCATG
GAGAGTCCGAATGGAATCAGAAGAACCTATTCTGCGGATGGTTCGATGCC
AAGCTATCGGAGAAGGGGCAGCAGGAGGCCTGTGCCGCTGGCAAAGCGCT
CAAAGATGCCAAAATTGAGTTCGATGTGGCCCACACCTCGGTGCTGACCA
GAGCCCAGGAGACACTCAGGGCCGCCCTAAAGTCCAGCGAGCACAAGAAG
ATTCCGGTGTGCACCACGTGGCGCCTCAACGAGCGCCACTACGGCGGACT
GACGGGACTGAATAAGGCCGAGACCGCCAAGAAGTTCGGCGAGGAGAAGG
TTAAGATCTGGCGCCGCAGCTTTGACACCCCACCGCCGCCAATGGAGAAG
GATCACGAGTACTACGCCTGCATTGTTGAGGATCCGCGCTACAAGGACCA
ACTGAAGCCGGAGGAGTTCCCCAAATCCGAGTCCCTCAAGCTCACCATCG
AGCGCACCTTGCCCTACTGGAACGAGGTCATAGTGCCCCAGATCAAGGAT
GGAATGCGTGTCCTGATCGCCGCCCACGGCAACAGCCTGCGGGGCGTGGT
CAAGCACTTGGAATGCATCTCTGACAAGGACATTATGAGCCTCAACCTGC
CCACTGGCATTCCTTTCGTCTACGAACTAGACGAGAGCCTCAAGCCTTTG
GCCACGTTGAAGTTCCTCGGCGATCCGGAGACGGTGAAGAAGGCAATGGA
GTCGGTGGCCAACCAGGGCAAAGCCAAGTGATCCGTGATTTTGGGTATAC
CCAGCAGCCTCCGAAGAAGGTCAGAGCAATCAGCTCAATGCACTTGTATG
CCAAACAAAAGCGGCGAATCGAAAGTGGTGCTCACTGTGGCCAGGCGAAT
GTCAAGAAGCAAATAAATTTATTTGATTTTAATTGAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH28416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Pglym87-RA 1427 Pglym87-RA 25..1110 1..1086 5430 100 Plus
Pglym78-RB 1487 Pglym78-RB 641..965 605..929 665 80.3 Plus
Pglym78-RC 1487 Pglym78-RC 641..965 605..929 665 80.3 Plus
Pglym78-RB 1487 Pglym78-RB 206..399 170..363 400 80.4 Plus
Pglym78-RC 1487 Pglym78-RC 206..399 170..363 400 80.4 Plus
Pglym78-RB 1487 Pglym78-RB 455..583 419..547 330 83.7 Plus
Pglym78-RC 1487 Pglym78-RC 455..583 419..547 330 83.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8057039..8058123 1085..1 5425 100 Minus
chr3R 27901430 chr3R 24971885..24972372 269..756 805 77.7 Plus
chr3R 27901430 chr3R 24972465..24972604 790..929 265 79.3 Plus
chr3R 27901430 chr3R 24971315..24971397 170..252 220 84.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:12:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12231644..12232729 1086..1 5430 100 Minus
3R 32079331 3R 29149011..29149498 269..756 790 77.5 Plus
3R 32079331 3R 29149594..29149733 790..929 295 80.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11972475..11973560 1086..1 5430 100 Minus
3R 31820162 3R 28890178..28890329 605..756 415 84.8 Plus
3R 31820162 3R 28889992..28890120 419..547 330 83.7 Plus
3R 31820162 3R 28890425..28890564 790..929 295 80.7 Plus
3R 31820162 3R 28889842..28889936 269..363 220 82.1 Plus
Blast to na_te.dros performed 2019-03-16 09:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
opus 7521 opus OPUS 7521bp 3988..4019 960..991 115 84.4 Plus

GH28416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:48:53 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8057039..8058123 1..1085 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:59:45 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 1..879 53..931 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:22:32 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 1..879 53..931 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:58:02 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 1..879 53..931 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:13:18 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 1..879 53..931 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:55 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 1..879 53..931 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:49:16 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 25..1109 1..1085 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:22:32 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 25..1109 1..1085 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:58:02 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 1..1085 1..1085 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:13:19 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 25..1109 1..1085 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:55 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym87-RA 1..1085 1..1085 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:53 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12231645..12232729 1..1085 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:53 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12231645..12232729 1..1085 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:53 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12231645..12232729 1..1085 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:58:02 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8057367..8058451 1..1085 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:46:05 Download gff for GH28416.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11972476..11973560 1..1085 100   Minus

GH28416.hyp Sequence

Translation from 0 to 930

> GH28416.hyp
NEHDIDCKHFPNSKCPKMLALARNSWCGQLLCRVANIEARCPFSKSSSGG
KQAEKKGKYRIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKAL
KDAKIEFDVAHTSVLTRAQETLRAALKSSEHKKIPVCTTWRLNERHYGGL
TGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRYKDQ
LKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVV
KHLECISDKDIMSLNLPTGIPFVYELDESLKPLATLKFLGDPETVKKAME
SVANQGKAK*

GH28416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Pglym87-PA 292 CG17645-PA 1..292 18..309 1544 100 Plus
Pglym78-PC 255 CG1721-PC 3..255 57..309 1042 75.9 Plus
Pglym78-PB 255 CG1721-PB 3..255 57..309 1042 75.9 Plus
Pglym78-PA 255 CG1721-PA 3..255 57..309 1042 75.9 Plus
CG7059-PC 253 CG7059-PC 6..252 60..306 486 41 Plus

GH28416.pep Sequence

Translation from 52 to 930

> GH28416.pep
MLALARNSWCGQLLCRVANIEARCPFSKSSSGGKQAEKKGKYRIVMVRHG
ESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTR
AQETLRAALKSSEHKKIPVCTTWRLNERHYGGLTGLNKAETAKKFGEEKV
KIWRRSFDTPPPPMEKDHEYYACIVEDPRYKDQLKPEEFPKSESLKLTIE
RTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECISDKDIMSLNLP
TGIPFVYELDESLKPLATLKFLGDPETVKKAMESVANQGKAK*

GH28416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17736-PA 288 GF17736-PA 1..288 1..292 1169 75.3 Plus
Dana\GF23292-PA 255 GF23292-PA 3..255 40..292 1012 75.5 Plus
Dana\GF18444-PA 265 GF18444-PA 18..265 43..290 513 42.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17149-PA 292 GG17149-PA 1..292 1..292 1529 96.9 Plus
Dere\GG11648-PA 255 GG11648-PA 3..255 40..292 1021 76.3 Plus
Dere\GG11129-PA 267 GG11129-PA 20..266 43..289 519 42.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15422-PA 247 GH15422-PA 1..247 46..292 1022 72.9 Plus
Dgri\GH23221-PA 255 GH23221-PA 3..255 40..292 1001 74.3 Plus
Dgri\GH14297-PA 255 GH14297-PA 3..255 40..292 1001 74.3 Plus
Dgri\GH13344-PA 265 GH13344-PA 18..264 43..289 537 40.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Pglym87-PA 292 CG17645-PA 1..292 1..292 1544 100 Plus
Pglym78-PC 255 CG1721-PC 3..255 40..292 1042 75.9 Plus
Pglym78-PB 255 CG1721-PB 3..255 40..292 1042 75.9 Plus
Pglym78-PA 255 CG1721-PA 3..255 40..292 1042 75.9 Plus
CG7059-PC 253 CG7059-PC 6..252 43..289 486 41 Plus
CG7059-PD 262 CG7059-PD 15..261 43..289 486 41 Plus
CG7059-PA 267 CG7059-PA 20..266 43..289 486 41 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10280-PA 293 GI10280-PA 42..293 41..292 1062 74.6 Plus
Dmoj\GI23192-PA 255 GI23192-PA 3..255 40..292 1003 74.3 Plus
Dmoj\GI22381-PA 268 GI22381-PA 21..267 43..289 541 41.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21564-PA 309 GL21564-PA 52..309 35..292 1172 84.1 Plus
Dper\GL23914-PA 255 GL23914-PA 3..255 40..292 1064 75.5 Plus
Dper\GL24208-PA 267 GL24208-PA 20..266 43..289 531 42.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:52:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14593-PA 290 GA14593-PA 33..290 35..292 1173 84.1 Plus
Dpse\GA14392-PA 255 GA14392-PA 3..255 40..292 1064 75.5 Plus
Dpse\GA20068-PA 267 GA20068-PA 20..266 43..289 531 42.6 Plus
Dpse\GA20068-PB 252 GA20068-PB 5..251 43..289 530 42.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:52:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26030-PA 292 GM26030-PA 1..292 1..292 1560 99.3 Plus
Dsec\GM12771-PA 255 GM12771-PA 3..255 40..292 1011 75.5 Plus
Dsec\GM26427-PA 267 GM26427-PA 20..266 43..289 506 41.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20588-PA 341 GD20588-PA 1..292 1..292 1534 97.3 Plus
Dsim\GD20944-PA 267 GD20944-PA 20..266 43..289 504 41.4 Plus
Dsim\GD21420-PA 429 GD21420-PA 3..110 40..147 476 79.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11087-PA 299 GJ11087-PA 48..299 41..292 1069 77 Plus
Dvir\GJ14508-PA 255 GJ14508-PA 3..255 40..292 1008 75.1 Plus
Dvir\GJ24414-PA 265 GJ24414-PA 18..264 43..289 514 41 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11893-PA 255 GK11893-PA 3..255 40..292 1068 75.5 Plus
Dwil\GK11561-PA 287 GK11561-PA 20..287 26..292 1045 71.3 Plus
Dwil\GK14265-PA 267 GK14265-PA 20..267 43..290 575 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24538-PA 292 GE24538-PA 1..292 1..292 1521 96.6 Plus
Dyak\Pglym78-PA 255 GE23839-PA 3..255 40..292 1015 75.9 Plus
Dyak\GE10295-PA 253 GE10295-PA 6..252 43..289 502 41.8 Plus