Clone GH28557 Report

Search the DGRC for GH28557

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:285
Well:57
Vector:pOT2
Associated Gene/TranscriptCG7770-RA
Protein status:GH28557.pep: gold
Preliminary Size:632
Sequenced Size:661

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7770 2002-01-01 Sim4 clustering to Release 2
CG7770 2002-05-18 Blastp of sequenced clone
CG7770 2003-01-01 Sim4 clustering to Release 3
CG7770 2008-04-29 Release 5.5 accounting
CG7770 2008-08-15 Release 5.9 accounting
CG7770 2008-12-18 5.12 accounting

Clone Sequence Records

GH28557.complete Sequence

661 bp (661 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118830

> GH28557.complete
ATTTGGGCACACTGCACGGTTTATTCACATGCAAAAGACGAAATTTAGTT
AAAATTATTAGCAACCGGTGAAGCAACTGTTTCATTAAACACCCTATTCC
GAACAAACACCTGCTGTATCTAAACCAAAATGGACAAGAAGAGCGCAGCG
TTGTACAAAAAGATGCAGGCCGAGATTGAGTCGTACCAGAACCTGCAAAA
ATCCTGCTTGAAGATGGTGAAGCAGCGAGCAGTGCTCGAAAGCCAGCTGA
ACGAGAACAAGTGCGTCCTGGACGAGCTGAATCTTCTGGGCCCCGACAAC
AAGGTCTACAAGCTCTTCGGGCCCGTTCTGGTCAAACAGGAGCTGGAGGA
GTCGCGCCAGAATGTCGGAAAGCGCATCGAGTACATCTCCAAGGAGCTGA
AGAGCTCCACCGACGCACTGGAGAACATGGAGAAGGACATGCTGAAGCAT
CGGGAATCCGTGGCCAAGTACCAACAGCAGTGTCAGGTGGCGGCGGCCAT
GCAGTAAATAAAGCATTTACCCCCGCATACATCTAATTTATAACTTATTT
TCGGACAGCTTGGTGGCTTTCGAAACTCAACTGGCACGACCGCTTTACCT
TAAAATGAATAAAACCCATTAAACCCTTAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

GH28557.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG7770-RA 935 CG7770-RA 91..722 1..632 3160 100 Plus
CG7770.a 788 CG7770.a 19..521 1..503 2515 100 Plus
CG7770.a 788 CG7770.a 522..595 559..632 370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19913308..19913534 203..429 1135 100 Plus
chr3L 24539361 chr3L 19913019..19913220 1..202 995 99.5 Plus
chr3L 24539361 chr3L 19913618..19913817 429..628 985 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:12:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19923982..19924208 203..429 1135 100 Plus
3L 28110227 3L 19924292..19924495 429..632 1020 100 Plus
3L 28110227 3L 19923693..19923894 1..202 1010 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19917082..19917308 203..429 1135 100 Plus
3L 28103327 3L 19917392..19917595 429..632 1020 100 Plus
3L 28103327 3L 19916793..19916994 1..202 1010 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:08:57 has no hits.

GH28557.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:09:37 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19913019..19913220 1..202 99 -> Plus
chr3L 19913308..19913533 203..428 100 -> Plus
chr3L 19913618..19913817 429..628 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:59:53 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 1..378 130..507 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:51:05 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 1..378 130..507 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:43:47 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 1..378 130..507 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:42:15 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 1..378 130..507 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:11:45 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 1..378 130..507 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:04:32 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 1..628 1..628 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:51:05 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 1..628 1..628 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:43:47 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 23..650 1..628 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:42:15 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 1..628 1..628 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:11:45 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
CG7770-RA 23..650 1..628 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:37 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19923693..19923894 1..202 100 -> Plus
3L 19923982..19924207 203..428 100 -> Plus
3L 19924292..19924491 429..628 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:37 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19923693..19923894 1..202 100 -> Plus
3L 19923982..19924207 203..428 100 -> Plus
3L 19924292..19924491 429..628 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:37 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19923693..19923894 1..202 100 -> Plus
3L 19923982..19924207 203..428 100 -> Plus
3L 19924292..19924491 429..628 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:43:47 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19916793..19916994 1..202 100 -> Plus
arm_3L 19917082..19917307 203..428 100 -> Plus
arm_3L 19917392..19917591 429..628 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:12:55 Download gff for GH28557.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19917082..19917307 203..428 100 -> Plus
3L 19917392..19917591 429..628 100   Plus
3L 19916793..19916994 1..202 100 -> Plus

GH28557.pep Sequence

Translation from 129 to 506

> GH28557.pep
MDKKSAALYKKMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDEL
NLLGPDNKVYKLFGPVLVKQELEESRQNVGKRIEYISKELKSSTDALENM
EKDMLKHRESVAKYQQQCQVAAAMQ*

GH28557.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23604-PA 125 GF23604-PA 1..125 1..125 602 92.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16068-PA 125 GG16068-PA 1..124 1..124 567 87.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16329-PA 125 GH16329-PA 1..125 1..125 585 89.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Pfdn6-PB 125 CG7770-PB 1..125 1..125 625 100 Plus
Pfdn6-PA 125 CG7770-PA 1..125 1..125 625 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13658-PA 125 GI13658-PA 1..125 1..125 569 86.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22669-PA 125 GL22669-PA 1..125 1..125 594 91.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20575-PA 125 GA20575-PA 1..125 1..125 594 91.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19687-PA 125 GM19687-PA 1..125 1..125 616 95.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14838-PA 125 GD14838-PA 1..125 1..125 620 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13994-PA 125 GJ13994-PA 1..125 1..125 591 90.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16968-PA 125 GK16968-PA 1..125 1..125 587 89.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19635-PA 125 GE19635-PA 1..124 1..124 578 89.5 Plus

GH28557.hyp Sequence

Translation from 129 to 506

> GH28557.hyp
MDKKSAALYKKMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDEL
NLLGPDNKVYKLFGPVLVKQELEESRQNVGKRIEYISKELKSSTDALENM
EKDMLKHRESVAKYQQQCQVAAAMQ*

GH28557.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG7770-PB 125 CG7770-PB 1..125 1..125 625 100 Plus
CG7770-PA 125 CG7770-PA 1..125 1..125 625 100 Plus