BDGP Sequence Production Resources |
Search the DGRC for GH28557
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 285 |
Well: | 57 |
Vector: | pOT2 |
Associated Gene/Transcript | CG7770-RA |
Protein status: | GH28557.pep: gold |
Preliminary Size: | 632 |
Sequenced Size: | 661 |
Gene | Date | Evidence |
---|---|---|
CG7770 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7770 | 2002-05-18 | Blastp of sequenced clone |
CG7770 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7770 | 2008-04-29 | Release 5.5 accounting |
CG7770 | 2008-08-15 | Release 5.9 accounting |
CG7770 | 2008-12-18 | 5.12 accounting |
661 bp (661 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118830
> GH28557.complete ATTTGGGCACACTGCACGGTTTATTCACATGCAAAAGACGAAATTTAGTT AAAATTATTAGCAACCGGTGAAGCAACTGTTTCATTAAACACCCTATTCC GAACAAACACCTGCTGTATCTAAACCAAAATGGACAAGAAGAGCGCAGCG TTGTACAAAAAGATGCAGGCCGAGATTGAGTCGTACCAGAACCTGCAAAA ATCCTGCTTGAAGATGGTGAAGCAGCGAGCAGTGCTCGAAAGCCAGCTGA ACGAGAACAAGTGCGTCCTGGACGAGCTGAATCTTCTGGGCCCCGACAAC AAGGTCTACAAGCTCTTCGGGCCCGTTCTGGTCAAACAGGAGCTGGAGGA GTCGCGCCAGAATGTCGGAAAGCGCATCGAGTACATCTCCAAGGAGCTGA AGAGCTCCACCGACGCACTGGAGAACATGGAGAAGGACATGCTGAAGCAT CGGGAATCCGTGGCCAAGTACCAACAGCAGTGTCAGGTGGCGGCGGCCAT GCAGTAAATAAAGCATTTACCCCCGCATACATCTAATTTATAACTTATTT TCGGACAGCTTGGTGGCTTTCGAAACTCAACTGGCACGACCGCTTTACCT TAAAATGAATAAAACCCATTAAACCCTTAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 19913308..19913534 | 203..429 | 1135 | 100 | Plus |
chr3L | 24539361 | chr3L | 19913019..19913220 | 1..202 | 995 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 19913618..19913817 | 429..628 | 985 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 19923982..19924208 | 203..429 | 1135 | 100 | Plus |
3L | 28110227 | 3L | 19924292..19924495 | 429..632 | 1020 | 100 | Plus |
3L | 28110227 | 3L | 19923693..19923894 | 1..202 | 1010 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 19917082..19917308 | 203..429 | 1135 | 100 | Plus |
3L | 28103327 | 3L | 19917392..19917595 | 429..632 | 1020 | 100 | Plus |
3L | 28103327 | 3L | 19916793..19916994 | 1..202 | 1010 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 19913019..19913220 | 1..202 | 99 | -> | Plus |
chr3L | 19913308..19913533 | 203..428 | 100 | -> | Plus |
chr3L | 19913618..19913817 | 429..628 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 1..378 | 130..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 1..378 | 130..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 1..378 | 130..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 1..378 | 130..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 1..378 | 130..507 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 1..628 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 1..628 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 23..650 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 1..628 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7770-RA | 23..650 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19923693..19923894 | 1..202 | 100 | -> | Plus |
3L | 19923982..19924207 | 203..428 | 100 | -> | Plus |
3L | 19924292..19924491 | 429..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19923693..19923894 | 1..202 | 100 | -> | Plus |
3L | 19923982..19924207 | 203..428 | 100 | -> | Plus |
3L | 19924292..19924491 | 429..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19923693..19923894 | 1..202 | 100 | -> | Plus |
3L | 19923982..19924207 | 203..428 | 100 | -> | Plus |
3L | 19924292..19924491 | 429..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 19916793..19916994 | 1..202 | 100 | -> | Plus |
arm_3L | 19917082..19917307 | 203..428 | 100 | -> | Plus |
arm_3L | 19917392..19917591 | 429..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19917082..19917307 | 203..428 | 100 | -> | Plus |
3L | 19917392..19917591 | 429..628 | 100 | Plus | |
3L | 19916793..19916994 | 1..202 | 100 | -> | Plus |
Translation from 129 to 506
> GH28557.pep MDKKSAALYKKMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDEL NLLGPDNKVYKLFGPVLVKQELEESRQNVGKRIEYISKELKSSTDALENM EKDMLKHRESVAKYQQQCQVAAAMQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23604-PA | 125 | GF23604-PA | 1..125 | 1..125 | 602 | 92.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16068-PA | 125 | GG16068-PA | 1..124 | 1..124 | 567 | 87.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16329-PA | 125 | GH16329-PA | 1..125 | 1..125 | 585 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pfdn6-PB | 125 | CG7770-PB | 1..125 | 1..125 | 625 | 100 | Plus |
Pfdn6-PA | 125 | CG7770-PA | 1..125 | 1..125 | 625 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13658-PA | 125 | GI13658-PA | 1..125 | 1..125 | 569 | 86.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22669-PA | 125 | GL22669-PA | 1..125 | 1..125 | 594 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20575-PA | 125 | GA20575-PA | 1..125 | 1..125 | 594 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19687-PA | 125 | GM19687-PA | 1..125 | 1..125 | 616 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14838-PA | 125 | GD14838-PA | 1..125 | 1..125 | 620 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13994-PA | 125 | GJ13994-PA | 1..125 | 1..125 | 591 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16968-PA | 125 | GK16968-PA | 1..125 | 1..125 | 587 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19635-PA | 125 | GE19635-PA | 1..124 | 1..124 | 578 | 89.5 | Plus |
Translation from 129 to 506
> GH28557.hyp MDKKSAALYKKMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDEL NLLGPDNKVYKLFGPVLVKQELEESRQNVGKRIEYISKELKSSTDALENM EKDMLKHRESVAKYQQQCQVAAAMQ*