Clone GH28782 Report

Search the DGRC for GH28782

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:287
Well:82
Vector:pOT2
Associated Gene/TranscriptCREG-RA
Protein status:GH28782.pep: gold
Preliminary Size:1077
Sequenced Size:921

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5413 2002-01-01 Sim4 clustering to Release 2
CG5413 2002-04-26 Blastp of sequenced clone
CREG 2008-04-29 Release 5.5 accounting
CREG 2008-08-15 Release 5.9 accounting
CREG 2008-12-18 5.12 accounting

Clone Sequence Records

GH28782.complete Sequence

921 bp (921 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113353

> GH28782.complete
ATCGCAAAGCAGAAGTACCGACAGGGGCCATTAGTCCAGATCCTCCAGTC
TAGCCATGAAAACCTTTCACTCCCTACTATTCGCCCTGATTTTGGCCCTC
GTGAGCCTGGACCCCTCTTCCGGTTACTCCCGCCGGAAAGATGAGCGTAT
AATTAGAGAATATAAGCGAGAGCAAGAGTTAAATCACGCCAAGATCGCCA
GAGATTTGGTCCATCGCGCCAATTGGGCGGCTGTGGGAAGTCTCTCCACC
AACGAACGGGTGAAGGGGTATCCCATGGTCAACATTATCTCCATCGACGA
CAGCGATGCTAATAACAGGTCCACTGGACGTATTCGATTCCTGCTAACCG
ATTTGGACTTCACTGGTCCCGACTGGCAGAAGGACAACAAGGTCACACTC
CTGTTCAGTGACGAGCAGACCCTAAGATGCAAGGAGGGCGGAAAGGATCC
CATGGAGCCTACATGTGCCCGTTCCATGATCAGTGGACAGGTGAAGAAGA
TGGATCCTAGCGACAAAAGCTATCAGCCATCGCTGGATGCCTATGTGAGG
CGTCATCCAGCTGCCATCAATTGGGTAAAAGCTCACAATTTCTACCTTTG
CGAACTGGAAATTAGCAATATCTTTGTTCTGGACTTCTATGGAGGTCCTC
ATAAAGTGAGCGCCTCTGACTATTACGCTGTTTCGAATTGATGAACTCCT
CCAAAAGCAATCCAACTGACGCCTCATATACTTTGTCAAAAAATGAAATG
ATAAGCATATTTGCACAACATGTCTGCCACAAAGGGAAAGAATGAAGACA
AAGGCCTTTATGAAAGCCACTTATCAGTTGAGCTCTGTGATTTCAATCGA
TAGAACAATAACTTTGATATAAATAAAAATACATTCCGTTGAATGTACTC
TGACAAAAAAAAAAAAAAAAA

GH28782.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
CREG-RB 1154 CREG-RB 203..1107 1..905 4525 100 Plus
CREG.c 1004 CREG.c 58..957 1..905 4425 99.4 Plus
CREG-RA 1041 CREG-RA 131..990 46..905 4300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13218188..13218641 499..46 2210 99.1 Minus
chr3R 27901430 chr3R 13217651..13217974 904..580 1515 98.5 Minus
chr3R 27901430 chr3R 13218045..13218128 581..498 420 100 Minus
chr3R 27901430 chr3R 13218908..13218955 48..1 240 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:12:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17393816..17394269 499..46 2270 100 Minus
3R 32079331 3R 17393277..17393602 905..580 1630 100 Minus
3R 32079331 3R 17393673..17393758 581..496 430 100 Minus
3R 32079331 3R 17394536..17394583 48..1 240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17134647..17135100 499..46 2270 100 Minus
3R 31820162 3R 17134108..17134433 905..580 1630 100 Minus
3R 31820162 3R 17134504..17134589 581..496 430 100 Minus
3R 31820162 3R 17135367..17135414 48..1 240 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:41:44 has no hits.

GH28782.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:42:27 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13217651..13217972 582..904 98 <- Minus
chr3R 13218045..13218126 500..581 100 <- Minus
chr3R 13218188..13218638 49..499 99 <- Minus
chr3R 13218908..13218955 1..48 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:00:17 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RB 1..636 56..691 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:21 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RB 1..636 56..691 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:59:04 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RA 1..636 56..691 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:39 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RB 1..636 56..691 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:18:09 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RA 1..636 56..691 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:37:12 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RB 1..904 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:20 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RB 58..961 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:59:04 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RB 58..961 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:40 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RB 1..904 1..904 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:09 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RB 58..961 1..904 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:27 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17393278..17393600 582..904 100 <- Minus
3R 17393673..17393754 500..581 100 <- Minus
3R 17393816..17394266 49..499 100 <- Minus
3R 17394536..17394583 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:27 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17393278..17393600 582..904 100 <- Minus
3R 17393673..17393754 500..581 100 <- Minus
3R 17393816..17394266 49..499 100 <- Minus
3R 17394536..17394583 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:27 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17393278..17393600 582..904 100 <- Minus
3R 17393673..17393754 500..581 100 <- Minus
3R 17393816..17394266 49..499 100 <- Minus
3R 17394536..17394583 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:59:04 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13219000..13219322 582..904 100 <- Minus
arm_3R 13219395..13219476 500..581 100 <- Minus
arm_3R 13219538..13219988 49..499 100 <- Minus
arm_3R 13220258..13220305 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:36 Download gff for GH28782.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17134109..17134431 582..904 100 <- Minus
3R 17134504..17134585 500..581 100 <- Minus
3R 17134647..17135097 49..499 100 <- Minus
3R 17135367..17135414 1..48 100   Minus

GH28782.pep Sequence

Translation from 55 to 690

> GH28782.pep
MKTFHSLLFALILALVSLDPSSGYSRRKDERIIREYKREQELNHAKIARD
LVHRANWAAVGSLSTNERVKGYPMVNIISIDDSDANNRSTGRIRFLLTDL
DFTGPDWQKDNKVTLLFSDEQTLRCKEGGKDPMEPTCARSMISGQVKKMD
PSDKSYQPSLDAYVRRHPAAINWVKAHNFYLCELEISNIFVLDFYGGPHK
VSASDYYAVSN*

GH28782.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16884-PA 211 GF16884-PA 7..209 7..209 883 77.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16779-PA 211 GG16779-PA 1..211 1..211 983 90.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17497-PA 212 GH17497-PA 10..211 7..210 735 65.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
CREG-PD 211 CG5413-PD 1..211 1..211 1107 100 Plus
CREG-PB 211 CG5413-PB 1..211 1..211 1107 100 Plus
CREG-PA 211 CG5413-PA 1..211 1..211 1107 100 Plus
CREG-PC 173 CG5413-PC 1..149 1..149 766 99.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22825-PA 207 GI22825-PA 3..205 7..209 776 67 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23943-PA 211 GL23943-PA 21..209 21..209 837 78.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18865-PA 211 GA18865-PA 1..209 1..209 867 73.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15369-PA 211 GM15369-PA 1..211 1..211 1036 94.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20237-PA 211 GD20237-PA 1..211 1..211 1038 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22827-PA 211 GJ22827-PA 8..209 8..209 755 66.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11455-PA 215 GK11455-PA 14..214 11..210 806 70.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24171-PA 211 GE24171-PA 23..211 23..211 985 94.7 Plus

GH28782.hyp Sequence

Translation from 55 to 690

> GH28782.hyp
MKTFHSLLFALILALVSLDPSSGYSRRKDERIIREYKREQELNHAKIARD
LVHRANWAAVGSLSTNERVKGYPMVNIISIDDSDANNRSTGRIRFLLTDL
DFTGPDWQKDNKVTLLFSDEQTLRCKEGGKDPMEPTCARSMISGQVKKMD
PSDKSYQPSLDAYVRRHPAAINWVKAHNFYLCELEISNIFVLDFYGGPHK
VSASDYYAVSN*

GH28782.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
CREG-PD 211 CG5413-PD 1..211 1..211 1107 100 Plus
CREG-PB 211 CG5413-PB 1..211 1..211 1107 100 Plus
CREG-PA 211 CG5413-PA 1..211 1..211 1107 100 Plus
CREG-PC 173 CG5413-PC 1..149 1..149 766 99.3 Plus