Clone GH28833 Report

Search the DGRC for GH28833

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:288
Well:33
Vector:pOT2
Associated Gene/TranscriptCG31248-RA
Protein status:GH28833.pep: gold
Preliminary Size:996
Sequenced Size:861

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2640 2001-01-01 Release 2 assignment
CG31248 2001-10-10 Blastp of sequenced clone
CG31248 2003-01-01 Sim4 clustering to Release 3
CG31248 2008-04-29 Release 5.5 accounting
CG31248 2008-08-15 Release 5.9 accounting
CG31248 2008-12-18 5.12 accounting

Clone Sequence Records

GH28833.complete Sequence

861 bp (861 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060818

> GH28833.complete
ACGCGGTTGCTTCTATACTTTGCTAGCTAGCTGGCTGACCGATAAGGCAT
TGAGAATGCGGATGGAAAACGGAAGACTCTGGGGAACGTTGCACGACGGC
AAATTTGAGGTGCGCAGTGTCACTCACTCCGACCTGGAAGAGGCGCTAGA
TGTTCTTGACGGCTCATTCTTTCTCAACGAATCTGTGTGTGTTGCCTGTG
AAATTAATTTGCCGGAAAATCGGCAAGCTCGTTTGGACTTGCGAGAGTTG
TGCAGAAAAACCGCTCTGGATGGTGTCTCATTGTTGGTTAAAGAGGCGGA
TACGGGTCGCGTAGTGTCCGTGTCGTTTAATAAAATTCAGTATGCACCAC
CACCTGGCGAGGATCACTTCTTTTTAAAATTCCGGAACGAGGAAGTTAAA
AGTCCTCAGGCAAGGCGTCTAATGGACTTTATGATCGAAGTGGATGGAAG
AATTGATGTGTGTGCCATGTTCAACATGGTGTGCTTCTGTGAACTGATGT
TTCTGGCCACTTTACCGAGCCACGAGCGATTGGGATTGGGTCGATCGTTG
TCCCAGTTCACAATTGAACTGACCAAGGAGCTGGCCGAAGGAAAGGGCCT
GGAGGATATCGATGATAAACTAAGATCAAAACGCCCAGCTGCCGTCACCG
CACTCTGGACCTCTAGATTCTCTCAAAAGGTTGGAAAAGCAACAGACTTT
AAAGTGATCAACACCGTTTCTTATTCGGAATTTGAGTACAAAGGGAAGAG
ATTTGACGAGCGAATTAACCTTATTCACAAGTTTTGCGAACATGTCATCT
ATAAATTTTAAAATACAAAAGTAAATGTTTGTAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

GH28833.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31248-RA 1114 CG31248-RA 277..1114 1..838 4190 100 Plus
CG31248.a 1818 CG31248.a 981..1818 1..838 4190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2956465..2956959 338..832 2460 99.8 Plus
chr3R 27901430 chr3R 2956225..2956413 152..340 945 100 Plus
chr3R 27901430 chr3R 2955516..2955614 1..99 495 100 Plus
chr3R 27901430 chr3R 2955675..2955730 98..153 280 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:12:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7130414..7130914 338..838 2505 100 Plus
3R 32079331 3R 7130174..7130362 152..340 945 100 Plus
3R 32079331 3R 7129465..7129563 1..99 495 100 Plus
3R 32079331 3R 7129624..7129679 98..153 280 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6871245..6871745 338..838 2505 100 Plus
3R 31820162 3R 6871005..6871193 152..340 945 100 Plus
3R 31820162 3R 6870296..6870394 1..99 495 100 Plus
3R 31820162 3R 6870455..6870510 98..153 280 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:20:30 has no hits.

GH28833.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:21:20 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2955516..2955613 1..98 100 -> Plus
chr3R 2955676..2955728 99..151 100 -> Plus
chr3R 2956225..2956413 152..340 100 -> Plus
chr3R 2956468..2956923 341..796 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:00:24 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 1..756 56..811 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:33:23 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 1..756 56..811 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:36 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 1..756 56..811 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:00:58 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 1..756 56..811 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:44:55 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 1..756 56..811 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:12:26 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 146..977 1..832 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:33:23 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 146..977 1..832 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:36 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 146..977 1..832 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:00:58 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 146..977 1..832 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:44:55 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG31248-RA 146..977 1..832 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:20 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7129465..7129562 1..98 100 -> Plus
3R 7129625..7129677 99..151 100 -> Plus
3R 7130174..7130362 152..340 100 -> Plus
3R 7130417..7130908 341..832 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:20 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7129465..7129562 1..98 100 -> Plus
3R 7129625..7129677 99..151 100 -> Plus
3R 7130174..7130362 152..340 100 -> Plus
3R 7130417..7130908 341..832 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:20 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7129465..7129562 1..98 100 -> Plus
3R 7129625..7129677 99..151 100 -> Plus
3R 7130174..7130362 152..340 100 -> Plus
3R 7130417..7130908 341..832 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:36 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2955187..2955284 1..98 100 -> Plus
arm_3R 2955347..2955399 99..151 100 -> Plus
arm_3R 2955896..2956084 152..340 100 -> Plus
arm_3R 2956139..2956630 341..832 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:37:46 Download gff for GH28833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6871248..6871739 341..832 100   Plus
3R 6870296..6870393 1..98 100 -> Plus
3R 6870456..6870508 99..151 100 -> Plus
3R 6871005..6871193 152..340 100 -> Plus

GH28833.hyp Sequence

Translation from 0 to 810

> GH28833.hyp
RGCFYTLLASWLTDKALRMRMENGRLWGTLHDGKFEVRSVTHSDLEEALD
VLDGSFFLNESVCVACEINLPENRQARLDLRELCRKTALDGVSLLVKEAD
TGRVVSVSFNKIQYAPPPGEDHFFLKFRNEEVKSPQARRLMDFMIEVDGR
IDVCAMFNMVCFCELMFLATLPSHERLGLGRSLSQFTIELTKELAEGKGL
EDIDDKLRSKRPAAVTALWTSRFSQKVGKATDFKVINTVSYSEFEYKGKR
FDERINLIHKFCEHVIYKF*

GH28833.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG31248-PB 251 CG31248-PB 1..251 19..269 1306 100 Plus
CG31248-PA 251 CG31248-PA 1..251 19..269 1306 100 Plus
CG31493-PA 246 CG31493-PA 7..218 30..243 173 26.6 Plus

GH28833.pep Sequence

Translation from 55 to 810

> GH28833.pep
MRMENGRLWGTLHDGKFEVRSVTHSDLEEALDVLDGSFFLNESVCVACEI
NLPENRQARLDLRELCRKTALDGVSLLVKEADTGRVVSVSFNKIQYAPPP
GEDHFFLKFRNEEVKSPQARRLMDFMIEVDGRIDVCAMFNMVCFCELMFL
ATLPSHERLGLGRSLSQFTIELTKELAEGKGLEDIDDKLRSKRPAAVTAL
WTSRFSQKVGKATDFKVINTVSYSEFEYKGKRFDERINLIHKFCEHVIYK
F*

GH28833.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17653-PA 251 GF17653-PA 1..247 1..247 1119 83.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13841-PA 251 GG13841-PA 1..251 1..251 1256 94 Plus
Dere\GG13852-PA 246 GG13852-PA 7..233 12..232 177 25.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19005-PA 255 GH19005-PA 1..255 1..251 850 61.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31248-PB 251 CG31248-PB 1..251 1..251 1306 100 Plus
CG31248-PA 251 CG31248-PA 1..251 1..251 1306 100 Plus
CG31493-PA 246 CG31493-PA 7..218 12..225 173 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23060-PA 238 GI23060-PA 1..238 1..251 886 64.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12419-PA 433 GL12419-PA 183..433 1..251 1083 78.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16122-PA 251 GA16122-PA 1..251 1..251 1075 77.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10934-PA 251 GM10934-PA 1..251 1..251 1291 96.4 Plus
Dsec\GM10935-PA 185 GM10935-PA 40..158 112..226 143 28.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19914-PA 246 GD19914-PA 9..219 14..226 189 27.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24572-PA 251 GJ24572-PA 1..251 1..251 887 61.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14520-PA 251 GK14520-PA 1..251 1..251 979 71.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24904-PA 251 GE24904-PA 1..251 1..251 1209 89.6 Plus
Dyak\GE24905-PA 245 GE24905-PA 7..228 12..235 202 27.6 Plus
Dyak\GE15039-PA 245 GE15039-PA 7..228 12..235 200 27.6 Plus