BDGP Sequence Production Resources |
Search the DGRC for GH28833
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 288 |
Well: | 33 |
Vector: | pOT2 |
Associated Gene/Transcript | CG31248-RA |
Protein status: | GH28833.pep: gold |
Preliminary Size: | 996 |
Sequenced Size: | 861 |
Gene | Date | Evidence |
---|---|---|
CG2640 | 2001-01-01 | Release 2 assignment |
CG31248 | 2001-10-10 | Blastp of sequenced clone |
CG31248 | 2003-01-01 | Sim4 clustering to Release 3 |
CG31248 | 2008-04-29 | Release 5.5 accounting |
CG31248 | 2008-08-15 | Release 5.9 accounting |
CG31248 | 2008-12-18 | 5.12 accounting |
861 bp (861 high quality bases) assembled on 2001-10-10
GenBank Submission: AY060818
> GH28833.complete ACGCGGTTGCTTCTATACTTTGCTAGCTAGCTGGCTGACCGATAAGGCAT TGAGAATGCGGATGGAAAACGGAAGACTCTGGGGAACGTTGCACGACGGC AAATTTGAGGTGCGCAGTGTCACTCACTCCGACCTGGAAGAGGCGCTAGA TGTTCTTGACGGCTCATTCTTTCTCAACGAATCTGTGTGTGTTGCCTGTG AAATTAATTTGCCGGAAAATCGGCAAGCTCGTTTGGACTTGCGAGAGTTG TGCAGAAAAACCGCTCTGGATGGTGTCTCATTGTTGGTTAAAGAGGCGGA TACGGGTCGCGTAGTGTCCGTGTCGTTTAATAAAATTCAGTATGCACCAC CACCTGGCGAGGATCACTTCTTTTTAAAATTCCGGAACGAGGAAGTTAAA AGTCCTCAGGCAAGGCGTCTAATGGACTTTATGATCGAAGTGGATGGAAG AATTGATGTGTGTGCCATGTTCAACATGGTGTGCTTCTGTGAACTGATGT TTCTGGCCACTTTACCGAGCCACGAGCGATTGGGATTGGGTCGATCGTTG TCCCAGTTCACAATTGAACTGACCAAGGAGCTGGCCGAAGGAAAGGGCCT GGAGGATATCGATGATAAACTAAGATCAAAACGCCCAGCTGCCGTCACCG CACTCTGGACCTCTAGATTCTCTCAAAAGGTTGGAAAAGCAACAGACTTT AAAGTGATCAACACCGTTTCTTATTCGGAATTTGAGTACAAAGGGAAGAG ATTTGACGAGCGAATTAACCTTATTCACAAGTTTTGCGAACATGTCATCT ATAAATTTTAAAATACAAAAGTAAATGTTTGTAAAAAAAAAAAAAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 2956465..2956959 | 338..832 | 2460 | 99.8 | Plus |
chr3R | 27901430 | chr3R | 2956225..2956413 | 152..340 | 945 | 100 | Plus |
chr3R | 27901430 | chr3R | 2955516..2955614 | 1..99 | 495 | 100 | Plus |
chr3R | 27901430 | chr3R | 2955675..2955730 | 98..153 | 280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 7130414..7130914 | 338..838 | 2505 | 100 | Plus |
3R | 32079331 | 3R | 7130174..7130362 | 152..340 | 945 | 100 | Plus |
3R | 32079331 | 3R | 7129465..7129563 | 1..99 | 495 | 100 | Plus |
3R | 32079331 | 3R | 7129624..7129679 | 98..153 | 280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 6871245..6871745 | 338..838 | 2505 | 100 | Plus |
3R | 31820162 | 3R | 6871005..6871193 | 152..340 | 945 | 100 | Plus |
3R | 31820162 | 3R | 6870296..6870394 | 1..99 | 495 | 100 | Plus |
3R | 31820162 | 3R | 6870455..6870510 | 98..153 | 280 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 2955516..2955613 | 1..98 | 100 | -> | Plus |
chr3R | 2955676..2955728 | 99..151 | 100 | -> | Plus |
chr3R | 2956225..2956413 | 152..340 | 100 | -> | Plus |
chr3R | 2956468..2956923 | 341..796 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 1..756 | 56..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 1..756 | 56..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 1..756 | 56..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 1..756 | 56..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 1..756 | 56..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 146..977 | 1..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 146..977 | 1..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 146..977 | 1..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 146..977 | 1..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31248-RA | 146..977 | 1..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7129465..7129562 | 1..98 | 100 | -> | Plus |
3R | 7129625..7129677 | 99..151 | 100 | -> | Plus |
3R | 7130174..7130362 | 152..340 | 100 | -> | Plus |
3R | 7130417..7130908 | 341..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7129465..7129562 | 1..98 | 100 | -> | Plus |
3R | 7129625..7129677 | 99..151 | 100 | -> | Plus |
3R | 7130174..7130362 | 152..340 | 100 | -> | Plus |
3R | 7130417..7130908 | 341..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7129465..7129562 | 1..98 | 100 | -> | Plus |
3R | 7129625..7129677 | 99..151 | 100 | -> | Plus |
3R | 7130174..7130362 | 152..340 | 100 | -> | Plus |
3R | 7130417..7130908 | 341..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 2955187..2955284 | 1..98 | 100 | -> | Plus |
arm_3R | 2955347..2955399 | 99..151 | 100 | -> | Plus |
arm_3R | 2955896..2956084 | 152..340 | 100 | -> | Plus |
arm_3R | 2956139..2956630 | 341..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6871248..6871739 | 341..832 | 100 | Plus | |
3R | 6870296..6870393 | 1..98 | 100 | -> | Plus |
3R | 6870456..6870508 | 99..151 | 100 | -> | Plus |
3R | 6871005..6871193 | 152..340 | 100 | -> | Plus |
Translation from 0 to 810
> GH28833.hyp RGCFYTLLASWLTDKALRMRMENGRLWGTLHDGKFEVRSVTHSDLEEALD VLDGSFFLNESVCVACEINLPENRQARLDLRELCRKTALDGVSLLVKEAD TGRVVSVSFNKIQYAPPPGEDHFFLKFRNEEVKSPQARRLMDFMIEVDGR IDVCAMFNMVCFCELMFLATLPSHERLGLGRSLSQFTIELTKELAEGKGL EDIDDKLRSKRPAAVTALWTSRFSQKVGKATDFKVINTVSYSEFEYKGKR FDERINLIHKFCEHVIYKF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31248-PB | 251 | CG31248-PB | 1..251 | 19..269 | 1306 | 100 | Plus |
CG31248-PA | 251 | CG31248-PA | 1..251 | 19..269 | 1306 | 100 | Plus |
CG31493-PA | 246 | CG31493-PA | 7..218 | 30..243 | 173 | 26.6 | Plus |
Translation from 55 to 810
> GH28833.pep MRMENGRLWGTLHDGKFEVRSVTHSDLEEALDVLDGSFFLNESVCVACEI NLPENRQARLDLRELCRKTALDGVSLLVKEADTGRVVSVSFNKIQYAPPP GEDHFFLKFRNEEVKSPQARRLMDFMIEVDGRIDVCAMFNMVCFCELMFL ATLPSHERLGLGRSLSQFTIELTKELAEGKGLEDIDDKLRSKRPAAVTAL WTSRFSQKVGKATDFKVINTVSYSEFEYKGKRFDERINLIHKFCEHVIYK F*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17653-PA | 251 | GF17653-PA | 1..247 | 1..247 | 1119 | 83.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13841-PA | 251 | GG13841-PA | 1..251 | 1..251 | 1256 | 94 | Plus |
Dere\GG13852-PA | 246 | GG13852-PA | 7..233 | 12..232 | 177 | 25.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19005-PA | 255 | GH19005-PA | 1..255 | 1..251 | 850 | 61.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31248-PB | 251 | CG31248-PB | 1..251 | 1..251 | 1306 | 100 | Plus |
CG31248-PA | 251 | CG31248-PA | 1..251 | 1..251 | 1306 | 100 | Plus |
CG31493-PA | 246 | CG31493-PA | 7..218 | 12..225 | 173 | 26.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23060-PA | 238 | GI23060-PA | 1..238 | 1..251 | 886 | 64.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12419-PA | 433 | GL12419-PA | 183..433 | 1..251 | 1083 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16122-PA | 251 | GA16122-PA | 1..251 | 1..251 | 1075 | 77.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10934-PA | 251 | GM10934-PA | 1..251 | 1..251 | 1291 | 96.4 | Plus |
Dsec\GM10935-PA | 185 | GM10935-PA | 40..158 | 112..226 | 143 | 28.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19914-PA | 246 | GD19914-PA | 9..219 | 14..226 | 189 | 27.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24572-PA | 251 | GJ24572-PA | 1..251 | 1..251 | 887 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14520-PA | 251 | GK14520-PA | 1..251 | 1..251 | 979 | 71.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24904-PA | 251 | GE24904-PA | 1..251 | 1..251 | 1209 | 89.6 | Plus |
Dyak\GE24905-PA | 245 | GE24905-PA | 7..228 | 12..235 | 202 | 27.6 | Plus |
Dyak\GE15039-PA | 245 | GE15039-PA | 7..228 | 12..235 | 200 | 27.6 | Plus |