BDGP Sequence Production Resources |
Search the DGRC for GM01014
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 10 |
Well: | 14 |
Vector: | pBS SK- |
Associated Gene/Transcript | CG42365-RA |
Protein status: | GM01014.pep: gold |
Preliminary Size: | 1062 |
Sequenced Size: | 867 |
Gene | Date | Evidence |
---|---|---|
CG15675 | 2001-01-01 | Release 2 assignment |
CG15675 | 2002-03-19 | Blastp of sequenced clone |
CG15675 | 2003-01-01 | Sim4 clustering to Release 3 |
CG15675 | 2008-04-29 | Release 5.5 accounting |
CG15675 | 2008-08-15 | Release 5.9 accounting |
CG42365 | 2008-12-18 | 5.12 accounting |
867 bp (867 high quality bases) assembled on 2002-03-19
GenBank Submission: AY094739
> GM01014.complete AGCTGAGTATTTCGAATCTTTACAAAACAATCCATCTATTTAACGAGTGG CCTCTGACCAACACAACTCAGTATTAGCATAAACATTAAAAGGGACACAT TACAAAATTCTAAAAATTATAACCATGGAATCTGAAGCTCAAGAACGTAC TGCACCTGTATCTGCAAACAAAAGTGATTCATCAGCGGCACCTGTGCTCA ATATATCCGGAAGGGTCAAGTCAGAATGGAATACACCCCGTATTAGGGGC AAAAAGAAGCCGCCGGCTGTCTTGGAAGCACCCAAAGTGAATCCGCACAC ATTTCCAGCGATATTAAGCAGGATTCTACTGAAGACCAATGCTCCGCCTG CAGCTCCACCGAAGTTTAATCCAGCCGACGGCACACAGTACCTTTGCTTC CTGTGCCTCGAGAAGCCGGAGAGTCGAAAGCGCGTCTATCACATGTTCAT CACGACTGAAAAGGAGCTGGGAAGCGACTACGCGCACACCAGGAAGTTGT ACGAGAATCGCAAGGAATTCATATACACCAATAATATATCCGTGGAAACA GTCTGTGCACGAGCACTGTACCGTCGGGTTCAAAAGAAGTTCACAGATGT ACAGTGGAACAAGCTGGGCAACGTTTTCGAGACTGACATGGTCGGACGCA GTGATGTCTGGGGTATATCTAATCGAGTTTACGCTTTGCGTATCGAGGAG CACGAAAGACTATTTAATTACATTAAGTTTCTGAGCTCAACGAAGTGCTA ACTAACTACATTCGATTTTAAGTGCCAGTACGAATTGTGATATCTTGTGT TTATTTTTTATATTAAATCTCTGCTTTGCGGATTGTTTGATTACAGTAAA AAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 17553198..17554044 | 1..847 | 4205 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 21666748..21667596 | 1..849 | 4230 | 99.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 21667947..21668795 | 1..849 | 4230 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 732..789 | 841..784 | 119 | 67.2 | Minus |
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 3239..3331 | 66..160 | 110 | 61.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 17553198..17554044 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42365-RA | 1..627 | 125..751 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42365-RA | 1..627 | 125..751 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42365-RA | 1..627 | 125..751 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15675-RB | 1..627 | 125..751 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42365-RA | 1..627 | 125..751 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42365-RA | 2..848 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42365-RA | 2..848 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42365-RA | 62..908 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15675-RB | 2..848 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42365-RA | 62..908 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21666748..21667594 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21666748..21667594 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21666748..21667594 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 17554253..17555099 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21667947..21668793 | 1..847 | 99 | Plus |
Translation from 124 to 750
> GM01014.pep MESEAQERTAPVSANKSDSSAAPVLNISGRVKSEWNTPRIRGKKKPPAVL EAPKVNPHTFPAILSRILLKTNAPPAAPPKFNPADGTQYLCFLCLEKPES RKRVYHMFITTEKELGSDYAHTRKLYENRKEFIYTNNISVETVCARALYR RVQKKFTDVQWNKLGNVFETDMVGRSDVWGISNRVYALRIEEHERLFNYI KFLSSTKC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13257-PA | 455 | GF13257-PA | 270..455 | 24..208 | 663 | 67.2 | Plus |
Dana\GF13257-PA | 455 | GF13257-PA | 197..251 | 90..144 | 152 | 47.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22127-PA | 208 | GG22127-PA | 1..207 | 1..207 | 970 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42365-PA | 208 | CG15675-PB | 1..208 | 1..208 | 1095 | 100 | Plus |
CG42364-PB | 202 | CG42364-PB | 1..200 | 1..206 | 448 | 45.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10799-PA | 208 | GL10799-PA | 1..207 | 1..207 | 517 | 50.2 | Plus |
Dper\GL25192-PA | 208 | GL25192-PA | 1..207 | 1..207 | 491 | 48.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24493-PA | 208 | GA24493-PA | 1..207 | 1..207 | 524 | 50.2 | Plus |
Dpse\GA23722-PA | 208 | GA23722-PA | 1..207 | 1..207 | 496 | 49.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15850-PA | 449 | GM15850-PA | 246..448 | 5..207 | 1005 | 91.1 | Plus |
Dsec\GM15850-PA | 449 | GM15850-PA | 192..245 | 90..143 | 152 | 46.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11612-PA | 447 | GD11612-PA | 244..446 | 5..207 | 988 | 90.6 | Plus |
Dsim\GD11612-PA | 447 | GD11612-PA | 190..243 | 90..143 | 150 | 46.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19016-PA | 203 | GK19016-PA | 3..202 | 7..207 | 427 | 46.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12210-PA | 208 | GE12210-PA | 1..207 | 1..207 | 944 | 83.6 | Plus |
Translation from 124 to 750
> GM01014.hyp MESEAQERTAPVSANKSDSSAAPVLNISGRVKSEWNTPRIRGKKKPPAVL EAPKVNPHTFPAILSRILLKTNAPPAAPPKFNPADGTQYLCFLCLEKPES RKRVYHMFITTEKELGSDYAHTRKLYENRKEFIYTNNISVETVCARALYR RVQKKFTDVQWNKLGNVFETDMVGRSDVWGISNRVYALRIEEHERLFNYI KFLSSTKC*