Clone GM01152 Report

Search the DGRC for GM01152

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:11
Well:52
Vector:pBS SK-
Associated Gene/TranscriptCG3040-RA
Protein status:GM01152.pep: gold
Preliminary Size:1213
Sequenced Size:1009

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3040 2001-01-01 Release 2 assignment
CG3040 2001-10-10 Blastp of sequenced clone
CG3040 2003-01-01 Sim4 clustering to Release 3
CG3040 2008-04-29 Release 5.5 accounting
CG3040 2008-08-15 Release 5.9 accounting
CG3040 2008-12-18 5.12 accounting

Clone Sequence Records

GM01152.complete Sequence

1009 bp (1009 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060823

> GM01152.complete
TAAAACGCAAGCACAACGAGGATAGCGGAGCACACATACCGCGCAGGAAG
AGTGTGAGATCTGGATTTGTCATCAGTCGACCCGCCCACCTCTTAATTAG
GCGAAAAACCTTGAATTCCCTGGAGAGACCCCTGCTACAATGGGCAATAA
ACAGATAAAACAACAACTGGAGACGGCCCAGAAGACGGGAATCCTGAAGA
TATCCTTGCAGCGGCTGCAAGAATTCCCACTGCAGCTAAGGGCCTACCCG
AATGTCCTGAAAACCCTGGATCTCTCCGAGAATCGCTTCGAACGTGTGCC
CGACGAACTGGGCAAGCTGACGCTACTCAAGCACCTCAATCTAAGCGGAA
ATCGACTGGTGGAACTCAACGAGGTGGTGGGCGAACTGGCCAAGCTGGAG
GTGCTGTTGCTGATGGACAATATGCTGACAAGGCTGCCCAAAACCCTGGC
CAATTGCACGCACCTGAAGACCGTGAATCTGAGCAACAATCAGCTGAAGG
AGTTCCCCTCCATGCTGTGCGGTCTGAAGCAGCTGGATGTCCTGGACCTG
TCCAGGAACAAGATCACCGATGTGCCCGCCGATGTGGGCGGACTGTTTGT
GACCGAACTGAACCTTAACCAGAACCAAATATCCTCGCTGGCGGAGGAAG
TAGCCGATTGTCCCAAGCTGAAGACACTGCGGCTCGAGGAGAACTGCCTT
CAGGCAGCGGCCTTTACACCCAAGATCCTCAAGGACTCGAAAATCTGCAA
CCTGGCCGTCGACGGCAATCTGTTCAACTCGAAACAGTTCACCGATCTCG
ATGGCTACGATGTCTACATGGAGCGGTATACGGCGGTCAGGAAGAAGATG
TTCTAGACTCGATTCAGATCAAATCCCTTTTTTTTTTGTGTGTACCCCAG
CCTTTATTTATCCGAGTAAACTAATTTAATAGCTTAATTCAATATGTGTA
ATGTGTAAAACGATACGAATAAATCGGAAAAAGACAACTTTAAAAAAAAA
AAAAAAAAA

GM01152.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG3040-RA 1087 CG3040-RA 97..1087 1..991 4955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6864482..6865472 991..1 4955 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:13:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6972322..6973314 993..1 4965 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6980420..6981412 993..1 4965 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:40:18 has no hits.

GM01152.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:41:19 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6864482..6865472 1..991 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:00:41 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 1..717 140..856 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:57 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 1..717 140..856 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:55:25 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 1..717 140..856 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:46 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 1..717 140..856 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:00:13 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 1..717 140..856 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:28 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 97..1087 1..991 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:57 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 97..1087 1..991 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:55:25 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 97..1087 1..991 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:46 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 97..1087 1..991 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:00:13 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3040-RA 80..1070 1..991 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:19 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
X 6972324..6973314 1..991 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:19 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
X 6972324..6973314 1..991 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:19 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
X 6972324..6973314 1..991 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:55:25 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6866357..6867347 1..991 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:40 Download gff for GM01152.complete
Subject Subject Range Query Range Percent Splice Strand
X 6980422..6981412 1..991 100   Minus

GM01152.pep Sequence

Translation from 139 to 855

> GM01152.pep
MGNKQIKQQLETAQKTGILKISLQRLQEFPLQLRAYPNVLKTLDLSENRF
ERVPDELGKLTLLKHLNLSGNRLVELNEVVGELAKLEVLLLMDNMLTRLP
KTLANCTHLKTVNLSNNQLKEFPSMLCGLKQLDVLDLSRNKITDVPADVG
GLFVTELNLNQNQISSLAEEVADCPKLKTLRLEENCLQAAAFTPKILKDS
KICNLAVDGNLFNSKQFTDLDGYDVYMERYTAVRKKMF*

GM01152.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20868-PA 238 GF20868-PA 1..238 1..238 1107 92 Plus
Dana\GF16442-PA 1847 GF16442-PA 154..323 40..210 208 35.5 Plus
Dana\GF16883-PA 641 GF16883-PA 412..587 13..185 194 30.1 Plus
Dana\GF16442-PA 1847 GF16442-PA 131..280 40..188 186 35.3 Plus
Dana\GF16442-PA 1847 GF16442-PA 226..394 19..188 181 32.7 Plus
Dana\GF16442-PA 1847 GF16442-PA 65..234 19..188 178 32.7 Plus
Dana\GF16883-PA 641 GF16883-PA 162..311 40..188 177 34 Plus
Dana\GF12306-PA 860 GF12306-PA 237..396 26..185 176 31.7 Plus
Dana\GF16883-PA 641 GF16883-PA 221..401 6..185 172 30.8 Plus
Dana\GF18150-PA 782 GF18150-PA 249..397 40..187 164 33.6 Plus
Dana\GF12306-PA 860 GF12306-PA 168..354 10..189 160 31 Plus
Dana\GF12306-PA 860 GF12306-PA 59..272 9..199 153 27 Plus
Dana\GF16883-PA 641 GF16883-PA 208..377 40..210 152 28.9 Plus
Dana\GF16883-PA 641 GF16883-PA 300..475 40..188 152 28.2 Plus
Dana\GF18150-PA 782 GF18150-PA 387..529 40..181 151 29.9 Plus
Dana\GF18150-PA 782 GF18150-PA 261..425 5..169 146 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17646-PA 238 GG17646-PA 1..238 1..238 1199 97.1 Plus
Dere\GG11485-PA 1855 GG11485-PA 154..323 40..210 199 34.9 Plus
Dere\GG16778-PA 644 GG16778-PA 415..590 13..185 191 30.1 Plus
Dere\GG11485-PA 1855 GG11485-PA 131..280 40..188 186 35.3 Plus
Dere\GG16778-PA 644 GG16778-PA 165..314 40..188 183 34.7 Plus
Dere\GG11485-PA 1855 GG11485-PA 223..371 40..187 180 34.4 Plus
Dere\GG11485-PA 1855 GG11485-PA 65..234 19..188 177 32.7 Plus
Dere\GG20492-PA 849 GG20492-PA 236..395 26..185 175 31.1 Plus
Dere\GG19722-PA 1256 GG19722-PA 21..183 29..188 171 35.2 Plus
Dere\GG16778-PA 644 GG16778-PA 224..409 6..192 168 30.2 Plus
Dere\GG20492-PA 849 GG20492-PA 167..376 10..214 161 30.7 Plus
Dere\GG19722-PA 1256 GG19722-PA 113..300 4..187 158 32.3 Plus
Dere\GG16778-PA 644 GG16778-PA 211..380 40..210 152 28.9 Plus
Dere\GG20492-PA 849 GG20492-PA 58..270 9..198 149 26.6 Plus
Dere\GG16778-PA 644 GG16778-PA 303..478 40..188 147 27.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12826-PA 238 GH12826-PA 1..238 1..238 1108 87.4 Plus
Dgri\GH18723-PA 1864 GH18723-PA 154..323 40..210 201 34.9 Plus
Dgri\GH18723-PA 1864 GH18723-PA 131..280 40..188 193 36 Plus
Dgri\GH17496-PA 622 GH17496-PA 393..568 13..185 191 30.7 Plus
Dgri\GH18723-PA 1864 GH18723-PA 223..371 40..187 188 35.1 Plus
Dgri\GH17496-PA 622 GH17496-PA 143..292 40..188 184 35.3 Plus
Dgri\GH23114-PA 340 GH23114-PA 28..152 66..189 180 36 Plus
Dgri\GH18723-PA 1864 GH18723-PA 65..234 19..188 179 32.7 Plus
Dgri\GH23114-PA 340 GH23114-PA 96..245 18..165 178 32.5 Plus
Dgri\GH21104-PA 910 GH21104-PA 240..397 6..163 177 30.2 Plus
Dgri\GH21104-PA 910 GH21104-PA 168..354 10..189 168 31 Plus
Dgri\GH23114-PA 340 GH23114-PA 71..217 40..185 161 32 Plus
Dgri\GH17496-PA 622 GH17496-PA 175..358 25..210 156 29.3 Plus
Dgri\GH17496-PA 622 GH17496-PA 201..382 5..185 156 29.6 Plus
Dgri\GH21104-PA 910 GH21104-PA 59..239 9..189 152 29.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG3040-PA 238 CG3040-PA 1..238 1..238 1201 100 Plus
scrib-PC 1247 CG43398-PC 154..323 40..210 228 34.9 Plus
scrib-PI 1711 CG43398-PI 154..323 40..210 228 34.9 Plus
scrib-PP 1729 CG43398-PP 154..323 40..210 228 34.9 Plus
scrib-PB 1756 CG43398-PB 154..323 40..210 228 34.9 Plus
scrib-PA 1756 CG43398-PA 154..323 40..210 228 34.9 Plus
scrib-PU 1766 CG43398-PU 154..323 40..210 228 34.9 Plus
scrib-PD 1851 CG43398-PD 154..323 40..210 228 34.9 Plus
scrib-PH 1939 CG43398-PH 154..323 40..210 228 34.9 Plus
scrib-PR 1951 CG43398-PR 154..323 40..210 228 34.9 Plus
scrib-PK 2331 CG43398-PK 154..323 40..210 228 34.9 Plus
scrib-PJ 2426 CG43398-PJ 154..323 40..210 228 34.9 Plus
scrib-PT 2444 CG43398-PT 154..323 40..210 228 34.9 Plus
scrib-PM 2490 CG43398-PM 154..323 40..210 228 34.9 Plus
scrib-PO 2515 CG43398-PO 154..323 40..210 228 34.9 Plus
scrib-PN 2554 CG43398-PN 154..323 40..210 228 34.9 Plus
scrib-PQ 2577 CG43398-PQ 154..323 40..210 228 34.9 Plus
scrib-PL 2585 CG43398-PL 154..323 40..210 228 34.9 Plus
Sur-8-PF 641 CG5407-PF 412..608 13..205 221 28.9 Plus
Sur-8-PB 641 CG5407-PB 412..608 13..205 221 28.9 Plus
Sur-8-PA 641 CG5407-PA 412..608 13..205 221 28.9 Plus
Sur-8-PE 694 CG5407-PE 412..608 13..205 221 28.9 Plus
scrib-PC 1247 CG43398-PC 209..371 25..187 211 32.9 Plus
scrib-PI 1711 CG43398-PI 209..371 25..187 211 32.9 Plus
scrib-PP 1729 CG43398-PP 209..371 25..187 211 32.9 Plus
scrib-PB 1756 CG43398-PB 209..371 25..187 211 32.9 Plus
scrib-PA 1756 CG43398-PA 209..371 25..187 211 32.9 Plus
scrib-PU 1766 CG43398-PU 209..371 25..187 211 32.9 Plus
scrib-PD 1851 CG43398-PD 209..371 25..187 211 32.9 Plus
scrib-PH 1939 CG43398-PH 209..371 25..187 211 32.9 Plus
scrib-PR 1951 CG43398-PR 209..371 25..187 211 32.9 Plus
scrib-PK 2331 CG43398-PK 209..371 25..187 211 32.9 Plus
scrib-PJ 2426 CG43398-PJ 209..371 25..187 211 32.9 Plus
scrib-PT 2444 CG43398-PT 209..371 25..187 211 32.9 Plus
scrib-PM 2490 CG43398-PM 209..371 25..187 211 32.9 Plus
scrib-PO 2515 CG43398-PO 209..371 25..187 211 32.9 Plus
scrib-PN 2554 CG43398-PN 209..371 25..187 211 32.9 Plus
scrib-PQ 2577 CG43398-PQ 209..371 25..187 211 32.9 Plus
scrib-PL 2585 CG43398-PL 209..371 25..187 211 32.9 Plus
scrib-PC 1247 CG43398-PC 98..280 6..188 209 31.5 Plus
scrib-PI 1711 CG43398-PI 98..280 6..188 209 31.5 Plus
scrib-PP 1729 CG43398-PP 98..280 6..188 209 31.5 Plus
scrib-PB 1756 CG43398-PB 98..280 6..188 209 31.5 Plus
scrib-PA 1756 CG43398-PA 98..280 6..188 209 31.5 Plus
scrib-PU 1766 CG43398-PU 98..280 6..188 209 31.5 Plus
scrib-PD 1851 CG43398-PD 98..280 6..188 209 31.5 Plus
scrib-PH 1939 CG43398-PH 98..280 6..188 209 31.5 Plus
scrib-PR 1951 CG43398-PR 98..280 6..188 209 31.5 Plus
scrib-PK 2331 CG43398-PK 98..280 6..188 209 31.5 Plus
scrib-PJ 2426 CG43398-PJ 98..280 6..188 209 31.5 Plus
scrib-PT 2444 CG43398-PT 98..280 6..188 209 31.5 Plus
scrib-PM 2490 CG43398-PM 98..280 6..188 209 31.5 Plus
scrib-PO 2515 CG43398-PO 98..280 6..188 209 31.5 Plus
scrib-PN 2554 CG43398-PN 98..280 6..188 209 31.5 Plus
scrib-PQ 2577 CG43398-PQ 98..280 6..188 209 31.5 Plus
scrib-PL 2585 CG43398-PL 98..280 6..188 209 31.5 Plus
Sur-8-PF 641 CG5407-PF 162..311 40..188 204 34.7 Plus
Sur-8-PB 641 CG5407-PB 162..311 40..188 204 34.7 Plus
Sur-8-PA 641 CG5407-PA 162..311 40..188 204 34.7 Plus
Sur-8-PE 694 CG5407-PE 162..311 40..188 204 34.7 Plus
CG11099-PB 378 CG11099-PB 5..175 18..187 200 32 Plus
CG11099-PA 378 CG11099-PA 5..175 18..187 200 32 Plus
Lap1-PB 849 CG10255-PB 236..395 26..185 197 31.1 Plus
Lap1-PA 849 CG10255-PA 236..395 26..185 197 31.1 Plus
scrib-PC 1247 CG43398-PC 58..234 9..188 194 32.6 Plus
scrib-PI 1711 CG43398-PI 58..234 9..188 194 32.6 Plus
scrib-PP 1729 CG43398-PP 58..234 9..188 194 32.6 Plus
scrib-PB 1756 CG43398-PB 58..234 9..188 194 32.6 Plus
scrib-PA 1756 CG43398-PA 58..234 9..188 194 32.6 Plus
scrib-PU 1766 CG43398-PU 58..234 9..188 194 32.6 Plus
scrib-PD 1851 CG43398-PD 58..234 9..188 194 32.6 Plus
scrib-PH 1939 CG43398-PH 58..234 9..188 194 32.6 Plus
scrib-PR 1951 CG43398-PR 58..234 9..188 194 32.6 Plus
scrib-PK 2331 CG43398-PK 58..234 9..188 194 32.6 Plus
scrib-PJ 2426 CG43398-PJ 58..234 9..188 194 32.6 Plus
scrib-PT 2444 CG43398-PT 58..234 9..188 194 32.6 Plus
scrib-PM 2490 CG43398-PM 58..234 9..188 194 32.6 Plus
scrib-PO 2515 CG43398-PO 58..234 9..188 194 32.6 Plus
scrib-PN 2554 CG43398-PN 58..234 9..188 194 32.6 Plus
scrib-PQ 2577 CG43398-PQ 58..234 9..188 194 32.6 Plus
scrib-PL 2585 CG43398-PL 58..234 9..188 194 32.6 Plus
Lap1-PB 849 CG10255-PB 167..376 10..214 194 30.7 Plus
Lap1-PA 849 CG10255-PA 167..376 10..214 194 30.7 Plus
fliI-PA 1256 CG1484-PA 113..300 4..187 193 31.7 Plus
Sur-8-PF 641 CG5407-PF 221..401 6..185 191 30.3 Plus
Sur-8-PB 641 CG5407-PB 221..401 6..185 191 30.3 Plus
Sur-8-PA 641 CG5407-PA 221..401 6..185 191 30.3 Plus
Sur-8-PE 694 CG5407-PE 221..401 6..185 191 30.3 Plus
f-cup-PD 474 CG9611-PD 50..252 6..185 185 27.9 Plus
f-cup-PI 522 CG9611-PI 98..300 6..185 185 27.9 Plus
f-cup-PC 522 CG9611-PC 98..300 6..185 185 27.9 Plus
f-cup-PH 571 CG9611-PH 128..330 6..185 185 27.9 Plus
f-cup-PE 620 CG9611-PE 98..300 6..185 185 27.9 Plus
f-cup-PB 650 CG9611-PB 128..330 6..185 185 27.9 Plus
f-cup-PA 693 CG9611-PA 171..373 6..185 185 27.9 Plus
f-cup-PG 759 CG9611-PG 128..330 6..185 185 27.9 Plus
f-cup-PF 802 CG9611-PF 171..373 6..185 185 27.9 Plus
Sur-8-PF 641 CG5407-PF 208..377 40..210 183 29.1 Plus
Sur-8-PB 641 CG5407-PB 208..377 40..210 183 29.1 Plus
Sur-8-PA 641 CG5407-PA 208..377 40..210 183 29.1 Plus
Sur-8-PE 694 CG5407-PE 208..377 40..210 183 29.1 Plus
Lrch-PA 809 CG6860-PA 83..271 3..187 182 31.4 Plus
Lrch-PC 1079 CG6860-PC 83..271 3..187 182 31.4 Plus
Lrch-PB 1135 CG6860-PB 83..271 3..187 182 31.4 Plus
Lrch-PA 809 CG6860-PA 64..246 4..210 177 28.2 Plus
Lrch-PC 1079 CG6860-PC 64..246 4..210 177 28.2 Plus
Lrch-PB 1135 CG6860-PB 64..246 4..210 177 28.2 Plus
CG10307-PB 341 CG10307-PB 41..219 6..187 177 29 Plus
CG10307-PA 341 CG10307-PA 41..219 6..187 177 29 Plus
Lap1-PB 849 CG10255-PB 58..236 9..187 175 29.4 Plus
Lap1-PA 849 CG10255-PA 58..236 9..187 175 29.4 Plus
f-cup-PD 474 CG9611-PD 175..317 40..181 174 31.2 Plus
f-cup-PI 522 CG9611-PI 223..365 40..181 174 31.2 Plus
f-cup-PC 522 CG9611-PC 223..365 40..181 174 31.2 Plus
f-cup-PH 571 CG9611-PH 253..395 40..181 174 31.2 Plus
f-cup-PE 620 CG9611-PE 223..365 40..181 174 31.2 Plus
f-cup-PB 650 CG9611-PB 253..395 40..181 174 31.2 Plus
f-cup-PA 693 CG9611-PA 296..438 40..181 174 31.2 Plus
f-cup-PG 759 CG9611-PG 253..395 40..181 174 31.2 Plus
f-cup-PF 802 CG9611-PF 296..438 40..181 174 31.2 Plus
f-cup-PD 474 CG9611-PD 37..185 40..187 172 32.2 Plus
f-cup-PI 522 CG9611-PI 85..233 40..187 172 32.2 Plus
f-cup-PC 522 CG9611-PC 85..233 40..187 172 32.2 Plus
f-cup-PH 571 CG9611-PH 115..263 40..187 172 32.2 Plus
f-cup-PE 620 CG9611-PE 85..233 40..187 172 32.2 Plus
f-cup-PB 650 CG9611-PB 115..263 40..187 172 32.2 Plus
f-cup-PA 693 CG9611-PA 158..306 40..187 172 32.2 Plus
f-cup-PG 759 CG9611-PG 115..263 40..187 172 32.2 Plus
f-cup-PF 802 CG9611-PF 158..306 40..187 172 32.2 Plus
scrib-PC 1247 CG43398-PC 25..185 26..185 171 29.8 Plus
scrib-PI 1711 CG43398-PI 25..185 26..185 171 29.8 Plus
scrib-PP 1729 CG43398-PP 25..185 26..185 171 29.8 Plus
scrib-PB 1756 CG43398-PB 25..185 26..185 171 29.8 Plus
scrib-PA 1756 CG43398-PA 25..185 26..185 171 29.8 Plus
scrib-PU 1766 CG43398-PU 25..185 26..185 171 29.8 Plus
scrib-PD 1851 CG43398-PD 25..185 26..185 171 29.8 Plus
scrib-PH 1939 CG43398-PH 25..185 26..185 171 29.8 Plus
scrib-PR 1951 CG43398-PR 25..185 26..185 171 29.8 Plus
scrib-PK 2331 CG43398-PK 25..185 26..185 171 29.8 Plus
scrib-PJ 2426 CG43398-PJ 25..185 26..185 171 29.8 Plus
scrib-PT 2444 CG43398-PT 25..185 26..185 171 29.8 Plus
scrib-PM 2490 CG43398-PM 25..185 26..185 171 29.8 Plus
scrib-PO 2515 CG43398-PO 25..185 26..185 171 29.8 Plus
scrib-PN 2554 CG43398-PN 25..185 26..185 171 29.8 Plus
scrib-PQ 2577 CG43398-PQ 25..185 26..185 171 29.8 Plus
scrib-PL 2585 CG43398-PL 25..185 26..185 171 29.8 Plus
CG32687-PB 377 CG32687-PB 132..259 38..164 171 29.7 Plus
CG32687-PA 377 CG32687-PA 132..259 38..164 171 29.7 Plus
Sur-8-PF 641 CG5407-PF 279..515 18..205 170 24.8 Plus
Sur-8-PB 641 CG5407-PB 279..515 18..205 170 24.8 Plus
Sur-8-PA 641 CG5407-PA 279..515 18..205 170 24.8 Plus
Sur-8-PE 694 CG5407-PE 279..515 18..205 170 24.8 Plus
scrib-PC 1247 CG43398-PC 211..396 4..167 168 29 Plus
scrib-PI 1711 CG43398-PI 211..396 4..167 168 29 Plus
scrib-PP 1729 CG43398-PP 211..396 4..167 168 29 Plus
scrib-PB 1756 CG43398-PB 211..396 4..167 168 29 Plus
scrib-PA 1756 CG43398-PA 211..396 4..167 168 29 Plus
scrib-PU 1766 CG43398-PU 211..396 4..167 168 29 Plus
scrib-PD 1851 CG43398-PD 211..396 4..167 168 29 Plus
scrib-PH 1939 CG43398-PH 211..396 4..167 168 29 Plus
scrib-PR 1951 CG43398-PR 211..396 4..167 168 29 Plus
scrib-PK 2331 CG43398-PK 211..396 4..167 168 29 Plus
scrib-PJ 2426 CG43398-PJ 211..396 4..167 168 29 Plus
scrib-PT 2444 CG43398-PT 211..396 4..167 168 29 Plus
scrib-PM 2490 CG43398-PM 211..396 4..167 168 29 Plus
scrib-PO 2515 CG43398-PO 211..396 4..167 168 29 Plus
scrib-PN 2554 CG43398-PN 211..396 4..167 168 29 Plus
scrib-PQ 2577 CG43398-PQ 211..396 4..167 168 29 Plus
scrib-PL 2585 CG43398-PL 211..396 4..167 168 29 Plus
ics-PC 283 CG9031-PC 75..226 40..185 168 32.2 Plus
ics-PB 283 CG9031-PB 75..226 40..185 168 32.2 Plus
ics-PA 283 CG9031-PA 75..226 40..185 168 32.2 Plus
fliI-PA 1256 CG1484-PA 152..348 19..187 163 31.8 Plus
Lap1-PB 849 CG10255-PB 29..238 26..214 161 24.9 Plus
Lap1-PA 849 CG10255-PA 29..238 26..214 161 24.9 Plus
ics-PC 283 CG9031-PC 30..220 43..207 160 28.4 Plus
ics-PB 283 CG9031-PB 30..220 43..207 160 28.4 Plus
ics-PA 283 CG9031-PA 30..220 43..207 160 28.4 Plus
Lrrk-PC 2422 CG5483-PC 433..595 16..176 160 26.8 Plus
Lrrk-PB 2445 CG5483-PB 456..618 16..176 160 26.8 Plus
Lrrk-PD 2513 CG5483-PD 524..686 16..176 160 26.8 Plus
fliI-PA 1256 CG1484-PA 7..198 40..225 159 29.7 Plus
CG10307-PB 341 CG10307-PB 28..151 66..188 159 30.2 Plus
CG10307-PA 341 CG10307-PA 28..151 66..188 159 30.2 Plus
Lrch-PA 809 CG6860-PA 135..278 4..149 154 31.3 Plus
Lrch-PC 1079 CG6860-PC 135..278 4..149 154 31.3 Plus
Lrch-PB 1135 CG6860-PB 135..278 4..149 154 31.3 Plus
CG32687-PB 377 CG32687-PB 40..278 7..206 154 26.2 Plus
CG32687-PA 377 CG32687-PA 40..278 7..206 154 26.2 Plus
2mit-PD 1141 CG42573-PD 312..463 40..190 153 31 Plus
2mit-PC 1141 CG42573-PC 312..463 40..190 153 31 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14698-PA 238 GI14698-PA 1..238 1..238 1058 88.2 Plus
Dmoj\GI22824-PA 471 GI22824-PA 273..417 40..185 196 33.3 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 154..323 40..210 195 34.3 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 131..280 40..188 193 35.3 Plus
Dmoj\GI22824-PA 471 GI22824-PA 135..284 40..188 190 36 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 226..394 19..188 188 33.3 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 65..234 19..188 178 32.7 Plus
Dmoj\GI18706-PA 906 GI18706-PA 237..396 26..185 177 32.3 Plus
Dmoj\GI18937-PA 335 GI18937-PA 71..220 40..188 176 33.3 Plus
Dmoj\GI18937-PA 335 GI18937-PA 28..148 66..185 168 36.4 Plus
Dmoj\GI18706-PA 906 GI18706-PA 170..354 12..189 161 30.5 Plus
Dmoj\GI22824-PA 471 GI22824-PA 167..345 25..205 148 28.6 Plus
Dmoj\GI18706-PA 906 GI18706-PA 54..237 4..187 146 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13411-PA 238 GL13411-PA 1..238 1..238 1040 88.7 Plus
Dper\GL23097-PA 1247 GL23097-PA 200..369 40..210 204 34.9 Plus
Dper\GL23097-PA 1247 GL23097-PA 177..326 40..188 187 35.3 Plus
Dper\GL23097-PA 1247 GL23097-PA 269..417 40..187 182 33.6 Plus
Dper\GL10166-PA 349 GL10166-PA 5..168 18..180 167 32.1 Plus
Dper\GL27344-PA 1929 GL27344-PA 466..628 16..176 166 28.7 Plus
Dper\GL23942-PA 333 GL23942-PA 34..214 6..185 163 30.3 Plus
Dper\GL23097-PA 1247 GL23097-PA 132..280 41..188 156 32.9 Plus
Dper\GL23942-PA 333 GL23942-PA 21..190 40..210 151 29.5 Plus
Dper\GL23942-PA 333 GL23942-PA 1..124 66..188 147 35.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15818-PA 238 GA15818-PA 1..238 1..238 1040 88.7 Plus
Dpse\GA18897-PA 1889 GA18897-PA 154..323 40..210 201 34.9 Plus
Dpse\GA27118-PA 629 GA27118-PA 400..575 13..185 191 30.1 Plus
Dpse\GA18897-PA 1889 GA18897-PA 131..280 40..188 185 35.3 Plus
Dpse\GA18897-PA 1889 GA18897-PA 223..371 40..187 180 34.4 Plus
Dpse\GA18897-PA 1889 GA18897-PA 65..234 19..188 175 32.2 Plus
Dpse\GA27118-PA 629 GA27118-PA 150..299 40..188 174 34 Plus
Dpse\GA10197-PA 848 GA10197-PA 236..395 26..185 173 31.1 Plus
Dpse\GA10758-PA 376 GA10758-PA 5..168 18..180 167 32.1 Plus
Dpse\GA27118-PA 629 GA27118-PA 209..389 6..185 163 30.3 Plus
Dpse\GA10197-PA 848 GA10197-PA 169..353 12..189 160 30.3 Plus
Dpse\GA27118-PA 629 GA27118-PA 182..365 25..210 153 28.2 Plus
Dpse\GA27118-PA 629 GA27118-PA 288..463 40..188 149 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17488-PA 238 GM17488-PA 1..238 1..238 1209 97.9 Plus
Dsec\GM10328-PA 1851 GM10328-PA 154..323 40..210 198 34.9 Plus
Dsec\GM15368-PA 683 GM15368-PA 415..590 13..185 192 30.1 Plus
Dsec\GM15368-PA 683 GM15368-PA 165..314 40..188 189 35.3 Plus
Dsec\GM10328-PA 1851 GM10328-PA 131..280 40..188 185 35.3 Plus
Dsec\GM10328-PA 1851 GM10328-PA 223..371 40..187 180 34.4 Plus
Dsec\GM10328-PA 1851 GM10328-PA 65..234 19..188 177 32.7 Plus
Dsec\GM25913-PA 898 GM25913-PA 266..430 5..169 177 31.9 Plus
Dsec\GM21584-PA 903 GM21584-PA 290..449 26..185 174 31.1 Plus
Dsec\GM15368-PA 683 GM15368-PA 224..409 6..192 171 30.2 Plus
Dsec\GM25913-PA 898 GM25913-PA 303..469 19..185 169 29.2 Plus
Dsec\GM21584-PA 903 GM21584-PA 221..430 10..214 158 30.7 Plus
Dsec\GM15368-PA 683 GM15368-PA 211..380 40..210 155 28.9 Plus
Dsec\GM25913-PA 898 GM25913-PA 254..404 40..189 152 31.8 Plus
Dsec\GM15368-PA 683 GM15368-PA 303..478 40..188 149 27.6 Plus
Dsec\GM21584-PA 903 GM21584-PA 112..325 9..199 147 26.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16172-PA 238 GD16172-PA 1..238 1..238 1209 97.9 Plus
Dsim\GD21289-PA 2647 GD21289-PA 154..323 40..210 198 34.9 Plus
Dsim\GD20236-PA 724 GD20236-PA 456..631 13..185 192 30.1 Plus
Dsim\GD21289-PA 2647 GD21289-PA 131..280 40..188 185 35.3 Plus
Dsim\GD20236-PA 724 GD20236-PA 206..355 40..188 184 34.7 Plus
Dsim\GD21289-PA 2647 GD21289-PA 223..371 40..187 179 34.4 Plus
Dsim\GD21289-PA 2647 GD21289-PA 65..234 19..188 176 32.7 Plus
Dsim\GD20236-PA 724 GD20236-PA 265..450 6..192 170 30.2 Plus
Dsim\GD11497-PA 378 GD11497-PA 5..168 18..180 164 32.7 Plus
Dsim\GD11618-PA 341 GD11618-PA 71..219 40..187 155 30.9 Plus
Dsim\GD20236-PA 724 GD20236-PA 252..421 40..210 153 28.9 Plus
Dsim\GD20236-PA 724 GD20236-PA 344..519 40..188 150 27.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16607-PA 238 GJ16607-PA 1..238 1..238 1067 89.1 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 385..560 13..185 190 30.1 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 135..284 40..188 184 35.3 Plus
Dvir\GJ20951-PA 385 GJ20951-PA 5..168 18..180 178 34.5 Plus
Dvir\GJ21726-PA 861 GJ21726-PA 237..396 26..185 174 31.7 Plus
Dvir\GJ19149-PA 1219 GJ19149-PA 113..299 4..166 169 32.6 Plus
Dvir\GJ21726-PA 861 GJ21726-PA 170..354 12..189 166 30.8 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 193..374 5..185 160 30.1 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 167..351 25..209 158 28 Plus
Dvir\GJ19149-PA 1219 GJ19149-PA 195..392 22..202 152 31.3 Plus
Dvir\GJ21726-PA 861 GJ21726-PA 59..237 9..187 149 30 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 273..448 40..188 148 28.7 Plus
Dvir\GJ19149-PA 1219 GJ19149-PA 7..138 40..167 147 34.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10093-PA 238 GK10093-PA 1..238 1..238 1140 90.8 Plus
Dwil\GK13318-PA 1874 GK13318-PA 154..323 40..210 200 34.9 Plus
Dwil\GK11454-PA 641 GK11454-PA 412..587 13..185 192 30.1 Plus
Dwil\GK13318-PA 1874 GK13318-PA 131..280 40..188 186 35.3 Plus
Dwil\GK11454-PA 641 GK11454-PA 300..453 40..189 185 33.8 Plus
Dwil\GK13318-PA 1874 GK13318-PA 226..394 19..188 183 32.7 Plus
Dwil\GK13318-PA 1874 GK13318-PA 65..234 19..188 179 32.7 Plus
Dwil\GK22461-PA 2454 GK22461-PA 460..631 16..181 178 28.9 Plus
Dwil\GK11454-PA 641 GK11454-PA 162..311 40..188 177 34 Plus
Dwil\GK21518-PA 831 GK21518-PA 236..402 26..194 176 31.2 Plus
Dwil\GK11454-PA 641 GK11454-PA 225..384 10..169 167 32.3 Plus
Dwil\GK21518-PA 831 GK21518-PA 169..353 12..189 162 30.8 Plus
Dwil\GK11454-PA 641 GK11454-PA 194..377 25..210 157 28.7 Plus
Dwil\GK21518-PA 831 GK21518-PA 58..271 9..199 156 27.9 Plus
Dwil\GK21518-PA 831 GK21518-PA 21..238 18..214 148 26.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17554-PA 238 GE17554-PA 1..238 1..238 1192 96.2 Plus
Dyak\GE23676-PA 1857 GE23676-PA 154..323 40..210 199 34.9 Plus
Dyak\GE24170-PA 645 GE24170-PA 416..591 13..185 192 30.1 Plus
Dyak\GE23676-PA 1857 GE23676-PA 131..280 40..188 186 35.3 Plus
Dyak\GE24170-PA 645 GE24170-PA 166..315 40..188 183 34.7 Plus
Dyak\GE23676-PA 1857 GE23676-PA 223..371 40..187 180 34.4 Plus
Dyak\GE13624-PA 849 GE13624-PA 236..395 26..185 178 31.7 Plus
Dyak\GE23676-PA 1857 GE23676-PA 65..234 19..188 177 32.7 Plus
Dyak\GE12094-PA 378 GE12094-PA 5..168 18..180 174 32.7 Plus
Dyak\GE24170-PA 645 GE24170-PA 225..410 6..192 170 30.2 Plus
Dyak\GE13624-PA 849 GE13624-PA 167..376 10..214 162 30.7 Plus
Dyak\GE24170-PA 645 GE24170-PA 212..381 40..210 153 28.9 Plus
Dyak\GE24170-PA 645 GE24170-PA 304..479 40..188 149 27.6 Plus
Dyak\GE13624-PA 849 GE13624-PA 58..271 9..199 149 26.5 Plus

GM01152.hyp Sequence

Translation from 139 to 855

> GM01152.hyp
MGNKQIKQQLETAQKTGILKISLQRLQEFPLQLRAYPNVLKTLDLSENRF
ERVPDELGKLTLLKHLNLSGNRLVELNEVVGELAKLEVLLLMDNMLTRLP
KTLANCTHLKTVNLSNNQLKEFPSMLCGLKQLDVLDLSRNKITDVPADVG
GLFVTELNLNQNQISSLAEEVADCPKLKTLRLEENCLQAAAFTPKILKDS
KICNLAVDGNLFNSKQFTDLDGYDVYMERYTAVRKKMF*

GM01152.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG3040-PA 238 CG3040-PA 1..238 1..238 1201 100 Plus
scrib-PC 1247 CG43398-PC 154..323 40..210 228 34.9 Plus
scrib-PI 1711 CG43398-PI 154..323 40..210 228 34.9 Plus
scrib-PP 1729 CG43398-PP 154..323 40..210 228 34.9 Plus
scrib-PB 1756 CG43398-PB 154..323 40..210 228 34.9 Plus
scrib-PC 1247 CG43398-PC 209..371 25..187 211 32.9 Plus
scrib-PI 1711 CG43398-PI 209..371 25..187 211 32.9 Plus
scrib-PP 1729 CG43398-PP 209..371 25..187 211 32.9 Plus
scrib-PC 1247 CG43398-PC 98..280 6..188 209 31.5 Plus
scrib-PI 1711 CG43398-PI 98..280 6..188 209 31.5 Plus
scrib-PP 1729 CG43398-PP 98..280 6..188 209 31.5 Plus
scrib-PC 1247 CG43398-PC 58..234 9..188 194 32.6 Plus
scrib-PI 1711 CG43398-PI 58..234 9..188 194 32.6 Plus
scrib-PP 1729 CG43398-PP 58..234 9..188 194 32.6 Plus
scrib-PC 1247 CG43398-PC 25..185 26..185 171 29.8 Plus
scrib-PI 1711 CG43398-PI 25..185 26..185 171 29.8 Plus
scrib-PP 1729 CG43398-PP 25..185 26..185 171 29.8 Plus
scrib-PC 1247 CG43398-PC 211..396 4..167 168 29 Plus
scrib-PI 1711 CG43398-PI 211..396 4..167 168 29 Plus
scrib-PP 1729 CG43398-PP 211..396 4..167 168 29 Plus