BDGP Sequence Production Resources |
Search the DGRC for GM01169
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 11 |
Well: | 69 |
Vector: | pBS SK- |
Associated Gene/Transcript | Spase12-RA |
Protein status: | GM01169.pep: gold |
Sequenced Size: | 433 |
Gene | Date | Evidence |
---|---|---|
Spase12 | 2009-06-08 | Manual selection by Joe Carlson |
433 bp assembled on 2009-07-28
GenBank Submission: BT088967.1
> GM01169.complete TGTGAATTGCACAAAATGTTGGACATCCAGACGCATATGGACTTCGCGGG TCAGGGAAAGGCGGAGCGCTGGTCGCGCTTCATCATCACGTTCTTCGGAA TTGTGGGCCTCGTCTACGGAGCCTTCGTGCAGCAGTTCTCACAGACCGTG TACATCCTGGGCGCCGGATTTGTGCTCTCCTCGCTGATCACCATTCCACC TTGGCCGCTGTACCGTCGCAATGCGCTCAAATGGCAGAAACCCATCGATA CGGATGCCAAGTCGTCGAGCTCCGAGTCCGGCGACGAGGGCAAGAAGAAG AAGAAGCAGTAGAATCAGTGGGATCAGTAGTTAGTTAGGCCAGCAGTTAC GTGTACTTCTCACTACATCCAATATAATATATATATACATATGTAAAAAA AAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Spase12-RA | 508 | Spase12-RA | 68..454 | 1..387 | 1905 | 99.4 | Plus |
CG2006-RA | 1890 | CG2006-RA | 1060..1261 | 387..186 | 980 | 99 | Minus |
CG2006-RA | 1890 | CG2006-RA | 1317..1464 | 186..39 | 740 | 100 | Minus |
CG2006-RA | 1890 | CG2006-RA | 1521..1560 | 40..1 | 200 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 25313143..25313352 | 395..186 | 1005 | 98.6 | Minus |
chr3R | 27901430 | chr3R | 25313408..25313555 | 186..39 | 740 | 100 | Minus |
chr3R | 27901430 | chr3R | 25313613..25313652 | 40..1 | 200 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29231384..29231585 | 387..186 | 980 | 99 | Minus |
3R | 31820162 | 3R | 29231641..29231788 | 186..39 | 740 | 100 | Minus |
3R | 31820162 | 3R | 29231845..29231884 | 40..1 | 200 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 7469..7509 | 284..324 | 106 | 73.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 25313144..25313351 | 187..394 | 98 | <- | Minus |
chr3R | 25313408..25313554 | 40..186 | 100 | <- | Minus |
chr3R | 25313614..25313652 | 1..39 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase12-RA | 1..297 | 16..312 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase12-RA | 1..297 | 16..312 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase12-RA | 1..297 | 16..312 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase12-RA | 1..297 | 16..312 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase12-RA | 42..437 | 1..394 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase12-RA | 68..463 | 1..394 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase12-RA | 98..493 | 1..394 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase12-RA | 98..493 | 1..394 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29490544..29490753 | 187..394 | 98 | <- | Minus |
3R | 29490810..29490956 | 40..186 | 100 | <- | Minus |
3R | 29491015..29491053 | 1..39 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29490544..29490753 | 187..394 | 98 | <- | Minus |
3R | 29490810..29490956 | 40..186 | 100 | <- | Minus |
3R | 29491015..29491053 | 1..39 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29490544..29490753 | 187..394 | 98 | <- | Minus |
3R | 29490810..29490956 | 40..186 | 100 | <- | Minus |
3R | 29491015..29491053 | 1..39 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 25316266..25316475 | 187..394 | 98 | <- | Minus |
arm_3R | 25316532..25316678 | 40..186 | 100 | <- | Minus |
arm_3R | 25316737..25316775 | 1..39 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29231375..29231584 | 187..394 | 98 | <- | Minus |
3R | 29231641..29231787 | 40..186 | 100 | <- | Minus |
3R | 29231846..29231884 | 1..39 | 100 | Minus |
Translation from 0 to 311
> GM01169.hyp CELHKMLDIQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTV YILGAGFVLSSLITIPPWPLYRRNALKWQKPIDTDAKSSSSESGDEGKKK KKQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Spase12-PA | 98 | CG11500-PA | 1..98 | 6..103 | 512 | 100 | Plus |
Translation from 0 to 311
> GM01169.pep CELHKMLDIQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTV YILGAGFVLSSLITIPPWPLYRRNALKWQKPIDTDAKSSSSESGDEGKKK KKQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF22889-PA | 97 | GF22889-PA | 1..97 | 6..102 | 434 | 90.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12017-PA | 98 | GG12017-PA | 1..98 | 6..103 | 508 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18698-PA | 99 | GH18698-PA | 1..97 | 6..102 | 408 | 75.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Spase12-PA | 98 | CG11500-PA | 1..98 | 6..103 | 512 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24466-PA | 97 | GI24466-PA | 1..97 | 6..102 | 420 | 75.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13590-PA | 97 | GL13590-PA | 1..97 | 6..102 | 418 | 77.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11036-PA | 97 | GA11036-PA | 1..97 | 6..102 | 418 | 77.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12242-PA | 98 | GM12242-PA | 1..98 | 6..103 | 513 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17775-PA | 98 | GD17775-PA | 1..98 | 6..103 | 513 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10558-PA | 97 | GJ10558-PA | 1..97 | 6..102 | 416 | 75.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11183-PA | 100 | GK11183-PA | 1..100 | 6..102 | 389 | 78 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10453-PA | 98 | GE10453-PA | 1..98 | 6..103 | 512 | 99 | Plus |