Clone GM01169 Report

Search the DGRC for GM01169

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:11
Well:69
Vector:pBS SK-
Associated Gene/TranscriptSpase12-RA
Protein status:GM01169.pep: gold
Sequenced Size:433

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Spase12 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

GM01169.complete Sequence

433 bp assembled on 2009-07-28

GenBank Submission: BT088967.1

> GM01169.complete
TGTGAATTGCACAAAATGTTGGACATCCAGACGCATATGGACTTCGCGGG
TCAGGGAAAGGCGGAGCGCTGGTCGCGCTTCATCATCACGTTCTTCGGAA
TTGTGGGCCTCGTCTACGGAGCCTTCGTGCAGCAGTTCTCACAGACCGTG
TACATCCTGGGCGCCGGATTTGTGCTCTCCTCGCTGATCACCATTCCACC
TTGGCCGCTGTACCGTCGCAATGCGCTCAAATGGCAGAAACCCATCGATA
CGGATGCCAAGTCGTCGAGCTCCGAGTCCGGCGACGAGGGCAAGAAGAAG
AAGAAGCAGTAGAATCAGTGGGATCAGTAGTTAGTTAGGCCAGCAGTTAC
GTGTACTTCTCACTACATCCAATATAATATATATATACATATGTAAAAAA
AAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAA

GM01169.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Spase12-RA 508 Spase12-RA 68..454 1..387 1905 99.4 Plus
CG2006-RA 1890 CG2006-RA 1060..1261 387..186 980 99 Minus
CG2006-RA 1890 CG2006-RA 1317..1464 186..39 740 100 Minus
CG2006-RA 1890 CG2006-RA 1521..1560 40..1 200 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25313143..25313352 395..186 1005 98.6 Minus
chr3R 27901430 chr3R 25313408..25313555 186..39 740 100 Minus
chr3R 27901430 chr3R 25313613..25313652 40..1 200 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:13:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29490553..29490754 387..186 980 99 Minus
3R 32079331 3R 29490810..29490957 186..39 740 100 Minus
3R 32079331 3R 29491014..29491053 40..1 200 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29231384..29231585 387..186 980 99 Minus
3R 31820162 3R 29231641..29231788 186..39 740 100 Minus
3R 31820162 3R 29231845..29231884 40..1 200 100 Minus
Blast to na_te.dros performed 2019-03-15 15:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 7469..7509 284..324 106 73.2 Plus

GM01169.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:06:49 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25313144..25313351 187..394 98 <- Minus
chr3R 25313408..25313554 40..186 100 <- Minus
chr3R 25313614..25313652 1..39 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:02 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
Spase12-RA 1..297 16..312 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:34 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
Spase12-RA 1..297 16..312 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:02:24 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
Spase12-RA 1..297 16..312 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:51 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
Spase12-RA 1..297 16..312 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 16:32:17 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
Spase12-RA 42..437 1..394 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:34 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
Spase12-RA 68..463 1..394 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:02:24 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
Spase12-RA 98..493 1..394 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:51 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
Spase12-RA 98..493 1..394 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:06:49 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29490544..29490753 187..394 98 <- Minus
3R 29490810..29490956 40..186 100 <- Minus
3R 29491015..29491053 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:06:49 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29490544..29490753 187..394 98 <- Minus
3R 29490810..29490956 40..186 100 <- Minus
3R 29491015..29491053 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:06:49 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29490544..29490753 187..394 98 <- Minus
3R 29490810..29490956 40..186 100 <- Minus
3R 29491015..29491053 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:02:24 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25316266..25316475 187..394 98 <- Minus
arm_3R 25316532..25316678 40..186 100 <- Minus
arm_3R 25316737..25316775 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:27 Download gff for GM01169.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29231375..29231584 187..394 98 <- Minus
3R 29231641..29231787 40..186 100 <- Minus
3R 29231846..29231884 1..39 100   Minus

GM01169.hyp Sequence

Translation from 0 to 311

> GM01169.hyp
CELHKMLDIQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTV
YILGAGFVLSSLITIPPWPLYRRNALKWQKPIDTDAKSSSSESGDEGKKK
KKQ*

GM01169.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Spase12-PA 98 CG11500-PA 1..98 6..103 512 100 Plus

GM01169.pep Sequence

Translation from 0 to 311

> GM01169.pep
CELHKMLDIQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTV
YILGAGFVLSSLITIPPWPLYRRNALKWQKPIDTDAKSSSSESGDEGKKK
KKQ*

GM01169.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22889-PA 97 GF22889-PA 1..97 6..102 434 90.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12017-PA 98 GG12017-PA 1..98 6..103 508 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18698-PA 99 GH18698-PA 1..97 6..102 408 75.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Spase12-PA 98 CG11500-PA 1..98 6..103 512 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24466-PA 97 GI24466-PA 1..97 6..102 420 75.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13590-PA 97 GL13590-PA 1..97 6..102 418 77.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11036-PA 97 GA11036-PA 1..97 6..102 418 77.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12242-PA 98 GM12242-PA 1..98 6..103 513 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17775-PA 98 GD17775-PA 1..98 6..103 513 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10558-PA 97 GJ10558-PA 1..97 6..102 416 75.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11183-PA 100 GK11183-PA 1..100 6..102 389 78 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10453-PA 98 GE10453-PA 1..98 6..103 512 99 Plus