Clone GM01172 Report

Search the DGRC for GM01172

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:11
Well:72
Vector:pBS SK-
Associated Gene/TranscriptCG10681-RA
Protein status:GM01172.pep: gold
Preliminary Size:1130
Sequenced Size:951

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10681 2001-01-01 Release 2 assignment
CG10681 2003-01-01 Sim4 clustering to Release 3
CG10681 2003-02-28 Blastp of sequenced clone
CG10681 2008-04-29 Release 5.5 accounting
CG10681 2008-08-15 Release 5.9 accounting
CG10681 2008-12-18 5.12 accounting

Clone Sequence Records

GM01172.complete Sequence

951 bp (951 high quality bases) assembled on 2003-02-28

GenBank Submission: BT004913

> GM01172.complete
GAAACATGAGATCCATTTGAAAACGTAAATAAAAATAGAAAAAAACTAAA
ACTGCCAGCAAACGCACACAAAGCAGAGTTCAAGTTGTCGCAAAGAAACC
TTGAGACCTTGAAAAGCTACAATGAGCCACTTGGGCCTTGCGGATGTGCA
CCAGTCCGAGGATGCCACTCCTGACCTGGAATCCTTCACTGGCTTCGGCA
ACTCCGCCGCCGAGGCCTTCATTCAAAGTCTCGCAGGAATGGTGAATCAG
GGCGATGTGGAGACCATGATACGGGCTCAAAAGCAAATGCTGCAACGCTT
TGAGAAAACCAACGAGATGCTGCTCAACTGCAATGCCTTATCGCAGAGTC
GTTTGAAAAGTGCCAGCGAGGATTTCAAAAGACACGTGAAATGCCTGAGC
GAAATGAAGAAGGATCTGGATTACATATTCCGCAAGATACGGATCATCAA
GCAGAAGCTACAGTCGCAGTTTCCCGCCATTTACGCCGAAGTTCAGCCGC
AGCGTAGCAGTTTGGCTGAGGAAGCCGAGGATGATACGGAAGCCCAGGCT
AAAAAGACTGCAGAAACACCTGCTCCTGCTGCCGCAAAACCTGTCCTATC
CACCAAGAAAAGTGCCGCCACCATAGAGTACGTGCAGATGGAGGAGGCAG
TGGACAATGGCACTGTGGAGATCGAAAACGAGCTGATCAAGCGAGTTTGT
TCCGTGGAAACTGCCAATCCCAATGATTCCTCCGACTGCACATCCGAGGA
TACAGGTTAAGCCTAATTAGCTTTAGTCCTTCGATATAATTATCTTCATA
TAATAACTTATTGGTTTAATATTTGTATAACCTGCTACTACATACAAGGA
CACAATTCGTTTAGTTAGATTTAAATGAAATATGCGTAATAATTTAAAAA
ACGAATGGCTTAAAATATAATCTGGTACTTGTAAAAAAAAAAAAAAAAAA
A

GM01172.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG10681-RA 1029 CG10681-RA 99..1029 1..932 4560 99.4 Plus
CG10681.a 1027 CG10681.a 93..1027 1..932 4495 99 Plus
CG10646-RA 1430 CG10646-RA 1248..1430 933..751 855 97.8 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12492610..12493253 289..932 3175 99.5 Plus
chr3L 24539361 chr3L 12492381..12492554 116..289 855 99.4 Plus
chr3L 24539361 chr3L 12492211..12492326 1..117 490 96.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:13:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12502004..12502648 289..933 3165 99.4 Plus
3L 28110227 3L 12501775..12501948 116..289 870 100 Plus
3L 28110227 3L 12501605..12501720 1..117 535 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12495104..12495748 289..933 3165 99.3 Plus
3L 28103327 3L 12494875..12495048 116..289 870 100 Plus
3L 28103327 3L 12494705..12494820 1..117 545 99.1 Plus
Blast to na_te.dros performed on 2019-03-16 19:52:45 has no hits.

GM01172.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:53:28 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12492211..12492324 1..115 96 -> Plus
chr3L 12492381..12492553 116..288 99 -> Plus
chr3L 12492610..12493253 289..932 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:00:42 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 1..639 122..760 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:36 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 1..639 122..760 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:26 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 1..639 122..760 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:32 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 1..639 122..760 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:45:21 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 1..639 122..760 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:58:33 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 1..935 1..932 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:36 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 93..1023 1..932 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:26 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 93..1023 1..932 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:30:32 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 1..935 1..932 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:45:21 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
CG10681-RA 93..1023 1..932 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:28 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12501605..12501718 1..115 99 -> Plus
3L 12501775..12501947 116..288 100 -> Plus
3L 12502004..12502647 289..932 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:28 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12501605..12501718 1..115 99 -> Plus
3L 12501775..12501947 116..288 100 -> Plus
3L 12502004..12502647 289..932 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:28 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12501605..12501718 1..115 99 -> Plus
3L 12501775..12501947 116..288 100 -> Plus
3L 12502004..12502647 289..932 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:26 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12494705..12494818 1..115 99 -> Plus
arm_3L 12494875..12495047 116..288 100 -> Plus
arm_3L 12495104..12495747 289..932 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:08:07 Download gff for GM01172.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12495104..12495747 289..932 99   Plus
3L 12494705..12494818 1..115 99 -> Plus
3L 12494875..12495047 116..288 100 -> Plus

GM01172.hyp Sequence

Translation from 121 to 759

> GM01172.hyp
MSHLGLADVHQSEDATPDLESFTGFGNSAAEAFIQSLAGMVNQGDVETMI
RAQKQMLQRFEKTNEMLLNCNALSQSRLKSASEDFKRHVKCLSEMKKDLD
YIFRKIRIIKQKLQSQFPAIYAEVQPQRSSLAEEAEDDTEAQAKKTAETP
APAAAKPVLSTKKSAATIEYVQMEEAVDNGTVEIENELIKRVCSVETANP
NDSSDCTSEDTG*

GM01172.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG10681-PB 212 CG10681-PB 1..212 1..212 1062 100 Plus
CG10681-PA 212 CG10681-PA 1..212 1..212 1062 100 Plus

GM01172.pep Sequence

Translation from 121 to 759

> GM01172.pep
MSHLGLADVHQSEDATPDLESFTGFGNSAAEAFIQSLAGMVNQGDVETMI
RAQKQMLQRFEKTNEMLLNCNALSQSRLKSASEDFKRHVKCLSEMKKDLD
YIFRKIRIIKQKLQSQFPAIYAEVQPQRSSLAEEAEDDTEAQAKKTAETP
APAAAKPVLSTKKSAATIEYVQMEEAVDNGTVEIENELIKRVCSVETANP
NDSSDCTSEDTG*

GM01172.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10429-PA 207 GF10429-PA 1..207 1..212 919 86.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15577-PA 212 GG15577-PA 1..212 1..212 1092 96.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14709-PA 210 GH14709-PA 1..210 9..212 843 77.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG10681-PB 212 CG10681-PB 1..212 1..212 1062 100 Plus
CG10681-PA 212 CG10681-PA 1..212 1..212 1062 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12256-PA 216 GI12256-PA 1..216 1..212 787 75.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25194-PA 216 GL25194-PA 1..216 1..212 940 82.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10490-PA 216 GA10490-PA 1..216 1..212 942 82.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25348-PA 212 GM25348-PA 1..212 1..212 1106 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14381-PA 212 GD14381-PA 1..212 1..212 1109 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11487-PA 216 GJ11487-PA 1..216 1..212 845 76.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12522-PA 258 GK12522-PA 4..122 18..131 547 87.4 Plus
Dwil\GK12522-PA 258 GK12522-PA 194..258 150..212 263 76.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21905-PA 212 GE21905-PA 1..212 1..212 1036 95.8 Plus