BDGP Sequence Production Resources |
Search the DGRC for GM01172
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 11 |
Well: | 72 |
Vector: | pBS SK- |
Associated Gene/Transcript | CG10681-RA |
Protein status: | GM01172.pep: gold |
Preliminary Size: | 1130 |
Sequenced Size: | 951 |
Gene | Date | Evidence |
---|---|---|
CG10681 | 2001-01-01 | Release 2 assignment |
CG10681 | 2003-01-01 | Sim4 clustering to Release 3 |
CG10681 | 2003-02-28 | Blastp of sequenced clone |
CG10681 | 2008-04-29 | Release 5.5 accounting |
CG10681 | 2008-08-15 | Release 5.9 accounting |
CG10681 | 2008-12-18 | 5.12 accounting |
951 bp (951 high quality bases) assembled on 2003-02-28
GenBank Submission: BT004913
> GM01172.complete GAAACATGAGATCCATTTGAAAACGTAAATAAAAATAGAAAAAAACTAAA ACTGCCAGCAAACGCACACAAAGCAGAGTTCAAGTTGTCGCAAAGAAACC TTGAGACCTTGAAAAGCTACAATGAGCCACTTGGGCCTTGCGGATGTGCA CCAGTCCGAGGATGCCACTCCTGACCTGGAATCCTTCACTGGCTTCGGCA ACTCCGCCGCCGAGGCCTTCATTCAAAGTCTCGCAGGAATGGTGAATCAG GGCGATGTGGAGACCATGATACGGGCTCAAAAGCAAATGCTGCAACGCTT TGAGAAAACCAACGAGATGCTGCTCAACTGCAATGCCTTATCGCAGAGTC GTTTGAAAAGTGCCAGCGAGGATTTCAAAAGACACGTGAAATGCCTGAGC GAAATGAAGAAGGATCTGGATTACATATTCCGCAAGATACGGATCATCAA GCAGAAGCTACAGTCGCAGTTTCCCGCCATTTACGCCGAAGTTCAGCCGC AGCGTAGCAGTTTGGCTGAGGAAGCCGAGGATGATACGGAAGCCCAGGCT AAAAAGACTGCAGAAACACCTGCTCCTGCTGCCGCAAAACCTGTCCTATC CACCAAGAAAAGTGCCGCCACCATAGAGTACGTGCAGATGGAGGAGGCAG TGGACAATGGCACTGTGGAGATCGAAAACGAGCTGATCAAGCGAGTTTGT TCCGTGGAAACTGCCAATCCCAATGATTCCTCCGACTGCACATCCGAGGA TACAGGTTAAGCCTAATTAGCTTTAGTCCTTCGATATAATTATCTTCATA TAATAACTTATTGGTTTAATATTTGTATAACCTGCTACTACATACAAGGA CACAATTCGTTTAGTTAGATTTAAATGAAATATGCGTAATAATTTAAAAA ACGAATGGCTTAAAATATAATCTGGTACTTGTAAAAAAAAAAAAAAAAAA A
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 12492610..12493253 | 289..932 | 3175 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 12492381..12492554 | 116..289 | 855 | 99.4 | Plus |
chr3L | 24539361 | chr3L | 12492211..12492326 | 1..117 | 490 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 12502004..12502648 | 289..933 | 3165 | 99.4 | Plus |
3L | 28110227 | 3L | 12501775..12501948 | 116..289 | 870 | 100 | Plus |
3L | 28110227 | 3L | 12501605..12501720 | 1..117 | 535 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 12495104..12495748 | 289..933 | 3165 | 99.3 | Plus |
3L | 28103327 | 3L | 12494875..12495048 | 116..289 | 870 | 100 | Plus |
3L | 28103327 | 3L | 12494705..12494820 | 1..117 | 545 | 99.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 12492211..12492324 | 1..115 | 96 | -> | Plus |
chr3L | 12492381..12492553 | 116..288 | 99 | -> | Plus |
chr3L | 12492610..12493253 | 289..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 1..639 | 122..760 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 1..639 | 122..760 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 1..639 | 122..760 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 1..639 | 122..760 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 1..639 | 122..760 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 1..935 | 1..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 93..1023 | 1..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 93..1023 | 1..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 1..935 | 1..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10681-RA | 93..1023 | 1..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12501605..12501718 | 1..115 | 99 | -> | Plus |
3L | 12501775..12501947 | 116..288 | 100 | -> | Plus |
3L | 12502004..12502647 | 289..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12501605..12501718 | 1..115 | 99 | -> | Plus |
3L | 12501775..12501947 | 116..288 | 100 | -> | Plus |
3L | 12502004..12502647 | 289..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12501605..12501718 | 1..115 | 99 | -> | Plus |
3L | 12501775..12501947 | 116..288 | 100 | -> | Plus |
3L | 12502004..12502647 | 289..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 12494705..12494818 | 1..115 | 99 | -> | Plus |
arm_3L | 12494875..12495047 | 116..288 | 100 | -> | Plus |
arm_3L | 12495104..12495747 | 289..932 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12495104..12495747 | 289..932 | 99 | Plus | |
3L | 12494705..12494818 | 1..115 | 99 | -> | Plus |
3L | 12494875..12495047 | 116..288 | 100 | -> | Plus |
Translation from 121 to 759
> GM01172.hyp MSHLGLADVHQSEDATPDLESFTGFGNSAAEAFIQSLAGMVNQGDVETMI RAQKQMLQRFEKTNEMLLNCNALSQSRLKSASEDFKRHVKCLSEMKKDLD YIFRKIRIIKQKLQSQFPAIYAEVQPQRSSLAEEAEDDTEAQAKKTAETP APAAAKPVLSTKKSAATIEYVQMEEAVDNGTVEIENELIKRVCSVETANP NDSSDCTSEDTG*
Translation from 121 to 759
> GM01172.pep MSHLGLADVHQSEDATPDLESFTGFGNSAAEAFIQSLAGMVNQGDVETMI RAQKQMLQRFEKTNEMLLNCNALSQSRLKSASEDFKRHVKCLSEMKKDLD YIFRKIRIIKQKLQSQFPAIYAEVQPQRSSLAEEAEDDTEAQAKKTAETP APAAAKPVLSTKKSAATIEYVQMEEAVDNGTVEIENELIKRVCSVETANP NDSSDCTSEDTG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10429-PA | 207 | GF10429-PA | 1..207 | 1..212 | 919 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15577-PA | 212 | GG15577-PA | 1..212 | 1..212 | 1092 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14709-PA | 210 | GH14709-PA | 1..210 | 9..212 | 843 | 77.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10681-PB | 212 | CG10681-PB | 1..212 | 1..212 | 1062 | 100 | Plus |
CG10681-PA | 212 | CG10681-PA | 1..212 | 1..212 | 1062 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12256-PA | 216 | GI12256-PA | 1..216 | 1..212 | 787 | 75.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25194-PA | 216 | GL25194-PA | 1..216 | 1..212 | 940 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10490-PA | 216 | GA10490-PA | 1..216 | 1..212 | 942 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25348-PA | 212 | GM25348-PA | 1..212 | 1..212 | 1106 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14381-PA | 212 | GD14381-PA | 1..212 | 1..212 | 1109 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11487-PA | 216 | GJ11487-PA | 1..216 | 1..212 | 845 | 76.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12522-PA | 258 | GK12522-PA | 4..122 | 18..131 | 547 | 87.4 | Plus |
Dwil\GK12522-PA | 258 | GK12522-PA | 194..258 | 150..212 | 263 | 76.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21905-PA | 212 | GE21905-PA | 1..212 | 1..212 | 1036 | 95.8 | Plus |