Clone GM01181 Report

Search the DGRC for GM01181

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:11
Well:81
Vector:pBS SK-
Associated Gene/TranscriptUK114-RA
Protein status:GM01181.pep: gold
Preliminary Size:723
Sequenced Size:510

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15261 2001-01-01 Release 2 assignment
CG15261 2002-06-06 Blastp of sequenced clone
CG15261 2003-01-01 Sim4 clustering to Release 3
CG15629 2003-01-01 Sim4 clustering to Release 3
UK114 2008-04-29 Release 5.5 accounting
UK114 2008-08-15 Release 5.9 accounting
UK114 2008-12-18 5.12 accounting

Clone Sequence Records

GM01181.complete Sequence

510 bp (510 high quality bases) assembled on 2002-06-06

GenBank Submission: AY119558

> GM01181.complete
CTTGTTCTTGCCACTTATATAGTATCGTATTTCGAGATCAAAATGTCGAC
GATTGTGAGGAAACTTATCAGCACTGCAAATGCTGCCAAGCCAGTGGCTC
CCTACAACCAGGCTGTGGTGGCCGATCGTACTGTGTATGTGTCCGGATGT
CTGGGTCTGGACAAGGACACCATGAAACTGGTTCCTGGAGGACCCACTGA
ACAAGCGCAGAAGGCATTGGAGAATCTGGAGGCTGTTCTAAAGGCGGCCG
ATTCCGGAGTGGACAAAGTCATCAAGAACACAGTGTTCTTGAAGGATCTC
AACGATTTCGGGGCAGTCAATGAGGTCTACAAGCGGGTGTTCAATAAGGA
TTTCCCGGCCCGCAGCTGTTTCCAGGTGGCCAAGCTGCCCATGGATGCTC
TGGTGGAGATCGAGTGCATTGCCTTGACCGGATCTGTGGAGACGAAAACC
GTGCAATAGCAACTAATGTCTAATAAATTGTGAGAAAAGTAAAAAAAAAA
AAAAAAAAAA

GM01181.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
UK114-RA 739 UK114-RA 110..605 1..496 2465 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15273355..15273584 337..108 1150 100 Minus
chr2L 23010047 chr2L 15272973..15273126 490..337 740 98.7 Minus
chr2L 23010047 chr2L 15273657..15273763 107..1 535 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:13:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15274620..15274849 337..108 1150 100 Minus
2L 23513712 2L 15274232..15274391 496..337 785 99.4 Minus
2L 23513712 2L 15274922..15275028 107..1 535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15274620..15274849 337..108 1150 100 Minus
2L 23513712 2L 15274232..15274391 496..337 785 99.3 Minus
2L 23513712 2L 15274922..15275028 107..1 535 100 Minus
Blast to na_te.dros performed 2019-03-16 01:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 4064..4091 326..299 104 85.7 Minus

GM01181.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:38:41 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15273355..15273584 108..337 100 <- Minus
chr2L 15272973..15273125 338..490 98 <- Minus
chr2L 15273657..15273763 1..107 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:00:43 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 1..417 43..459 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:31:24 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 1..417 43..459 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:56:05 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 1..417 43..459 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:21:30 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 1..417 43..459 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:38:58 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 1..417 43..459 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:01:29 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 1..490 1..490 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:31:24 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 33..522 1..490 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:56:05 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 64..553 1..490 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:21:30 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 1..490 1..490 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:38:58 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
UK114-RA 64..553 1..490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:41 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15274238..15274390 338..490 100 <- Minus
2L 15274620..15274849 108..337 100 <- Minus
2L 15274922..15275028 1..107 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:41 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15274238..15274390 338..490 100 <- Minus
2L 15274620..15274849 108..337 100 <- Minus
2L 15274922..15275028 1..107 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:41 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15274238..15274390 338..490 100 <- Minus
2L 15274620..15274849 108..337 100 <- Minus
2L 15274922..15275028 1..107 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:05 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15274238..15274390 338..490 100 <- Minus
arm_2L 15274620..15274849 108..337 100 <- Minus
arm_2L 15274922..15275028 1..107 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:55:22 Download gff for GM01181.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15274922..15275028 1..107 100   Minus
2L 15274620..15274849 108..337 100 <- Minus
2L 15274238..15274390 338..490 100 <- Minus

GM01181.hyp Sequence

Translation from 0 to 458

> GM01181.hyp
LVLATYIVSYFEIKMSTIVRKLISTANAAKPVAPYNQAVVADRTVYVSGC
LGLDKDTMKLVPGGPTEQAQKALENLEAVLKAADSGVDKVIKNTVFLKDL
NDFGAVNEVYKRVFNKDFPARSCFQVAKLPMDALVEIECIALTGSVETKT
VQ*

GM01181.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
UK114-PB 138 CG15261-PB 1..138 15..152 691 100 Plus
UK114-PA 138 CG15261-PA 1..138 15..152 691 100 Plus

GM01181.pep Sequence

Translation from 42 to 458

> GM01181.pep
MSTIVRKLISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGG
PTEQAQKALENLEAVLKAADSGVDKVIKNTVFLKDLNDFGAVNEVYKRVF
NKDFPARSCFQVAKLPMDALVEIECIALTGSVETKTVQ*

GM01181.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14530-PA 138 GF14530-PA 1..138 1..138 694 95.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24215-PA 138 GG24215-PA 1..138 1..138 700 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13123-PA 138 GH13123-PA 1..138 1..138 660 91.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
UK114-PB 138 CG15261-PB 1..138 1..138 691 100 Plus
UK114-PA 138 CG15261-PA 1..138 1..138 691 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22716-PA 138 GI22716-PA 1..134 1..134 641 90.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26599-PA 138 GL26599-PA 1..138 1..138 672 92 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13610-PA 138 GA13610-PA 1..138 1..138 672 92 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14467-PA 138 GM14467-PA 1..138 1..138 711 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21964-PA 138 GD21964-PA 1..138 1..138 709 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23277-PA 138 GJ23277-PA 1..138 1..138 655 90.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18257-PA 138 GK18257-PA 1..138 1..138 668 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19409-PA 138 GE19409-PA 1..138 1..138 707 97.8 Plus