Clone GM01182 Report

Search the DGRC for GM01182

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:11
Well:82
Vector:pBS SK-
Associated Gene/Transcriptdgrn-RA
Protein status:GM01182.pep: gold
Preliminary Size:1866
Sequenced Size:1660

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10981 2001-01-01 Release 2 assignment
CG10981 2001-10-10 Blastp of sequenced clone
CG10981 2008-04-29 Release 5.5 accounting
CG10981 2008-08-15 Release 5.9 accounting
CG10981 2008-12-18 5.12 accounting

Clone Sequence Records

GM01182.complete Sequence

1660 bp (1660 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060824

> GM01182.complete
TAATGTCGACATATTTATATACATTTCTTATAATTATTTTGTTATCAAAG
AATTTCGCCGAAACGGAAATTTTATTTTTAATAAATTATTGATTTTTATT
GAATTACAAGTGTCATTCTAAACAGCATTGTATAATACCGCAAAAATCGA
TAGTCGATCTTAAATCCTTGTTCCCGAATGTCCGTAAAGTGTCATCTTTA
AAATAACCGAATGGTCGCGTGAAAGGAGGAAACTATTTTGCACATTTCAA
TCTGCACTAAAGCACATGTATATCTGGGTTCACCTGCTTTTGTCTTTACT
ACGAAATCATTTCACAAGTTTCCTGGTCATTTGTTGCTCGAACAATGTCA
GATTCGACTATTTTCCGTTTTAACTCATCCATTCTTGATCAGTCAGCGGA
CAGCAACGTATCCAGTTCGAGCTCCAATTCCAGTGTATCCGACTCTTCTG
TGGACTCCCATTCATCCATAGAATCCAATTCGGGACACAATACATCCGTG
GAATCTCAGTCATCCGCGGAATCTGATTCATCCGCTGATTCCCATTCGTC
CTTGGAACGCCCATCCCCAGTGGAGCGTGATTTATCTGTGGAATCAGACT
CATCTTCAGCCACCAATACCAGCGAATCTTCAGTCGGAGAAGCTTCAAAC
CAACTGCAGTCACCGCAAAGCAATAACCCCTTAAATATGGCTAACTTGTC
TGTCTCGACTGAAGATGCTCATTCGCAGATCAGATCACTTACCCAGGATG
TGATCCAGATGGAAGCAGAGTTGGATCGCATGAATCGCTACTGCGAGGAA
GTTGTGGCACAGATTGACACCTTCGCCACGAGAACCTCAACGCCAACAAC
TCGTAGAATTCGCCGCAGAACGAGTCCAGTAGAAGTGATAGATCTGTCCC
ATTTGGACCGTGCACCACCTGTTCGATCCGCTCGGAATCGTGATCCCGAT
GCTTTCATCGATCTATGCACCCCCGAAGGCCCAAGAAGTCGCACAGTGAA
TCTTCACTCCAACGACTCCCTCACCATTCTGCCACGTCGGTCAGCCGAAA
ATGACCCGGTAGTGGATCTCGACGTTGCGTCGCCACCAAAACGCGTTAAT
CGCGACATTGATGAGTCCCAAAAAGAGGAGTTATACAAGTGCCCCATCTG
CATGGACAGTGTATCGAAGCGCGAGCCAGTGTCAACCAAATGTGGACACG
TCTTCTGCCGCGAATGCATCGAAACAGCCATCAGAGCTACGCACAAGTGC
CCAATATGCAACAAGAAGCTGACCGCACGTCAATTCTTTCGCATTTACTT
GTAAGTTGCTTATACTATTTCACATTTTTTGCTCTGTGAGCCTTAATATA
ATATAGTTTAAAAAAAAACGCTTAACTATGTTAGAGACGGCAAATAATGT
CTGTTCTTGTGATTCAGAAAAAATTAGTTATTTAAGTTGTCCTATGTAAT
CAGTGGCGCCCAAAAATATTTGAATACAACTATAAAAACTAAAGACTTCA
CTTTTGATGTATGAAACCATCTCAGGCTAGAATAATATAAGAACGACCGA
AAGGAGTGTCAAAGTATTATGTAGGCATTTTTCCAAACGCAATTTAACAA
TGTAACATACATATAATATAATAAATAAAATGGTCCCAACGCAAAAAAAA
AAAAAAAAAA

GM01182.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG10981-RA 1657 CG10981-RA 7..1649 1..1643 8215 100 Plus
CG10981-RB 1630 CG10981-RB 372..1622 393..1643 6255 100 Plus
CG10981-RB 1630 CG10981-RB 1..371 1..371 1855 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1651451..1652222 871..1642 3860 100 Plus
chr3R 27901430 chr3R 1650682..1651090 372..780 2045 100 Plus
chr3R 27901430 chr3R 1650251..1650621 1..371 1855 100 Plus
chr3R 27901430 chr3R 1651145..1651234 781..870 450 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:13:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5825805..5826577 871..1643 3865 100 Plus
3R 32079331 3R 5825036..5825444 372..780 2045 100 Plus
3R 32079331 3R 5824605..5824975 1..371 1855 100 Plus
3R 32079331 3R 5825499..5825588 781..870 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5566636..5567408 871..1643 3865 100 Plus
3R 31820162 3R 5565867..5566275 372..780 2045 100 Plus
3R 31820162 3R 5565436..5565806 1..371 1855 100 Plus
3R 31820162 3R 5566330..5566419 781..870 450 100 Plus
Blast to na_te.dros performed 2019-03-16 01:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6882..6992 115..1 114 59.1 Minus

GM01182.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:42:00 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1650682..1651090 372..780 100 -> Plus
chr3R 1651145..1651234 781..870 100 -> Plus
chr3R 1651451..1652189 871..1609 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:00:45 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RA 1..960 345..1304 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:04 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RA 1..960 345..1304 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:56:33 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
dgrn-RA 1..960 345..1304 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:16:46 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RA 1..960 345..1304 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:39:34 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
dgrn-RA 1..960 345..1304 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:31:59 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RA 1..1642 1..1642 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:04 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RA 1..1642 1..1642 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:56:33 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
dgrn-RA 1..1642 1..1642 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:16:46 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RA 1..1642 1..1642 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:39:34 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
dgrn-RA 1..1632 11..1642 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:42:00 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5824605..5824975 1..371 100 -> Plus
3R 5825036..5825444 372..780 100 -> Plus
3R 5825499..5825588 781..870 100 -> Plus
3R 5825805..5826576 871..1642 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:42:00 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5824605..5824975 1..371 100 -> Plus
3R 5825036..5825444 372..780 100 -> Plus
3R 5825499..5825588 781..870 100 -> Plus
3R 5825805..5826576 871..1642 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:42:00 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5824605..5824975 1..371 100 -> Plus
3R 5825036..5825444 372..780 100 -> Plus
3R 5825499..5825588 781..870 100 -> Plus
3R 5825805..5826576 871..1642 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:33 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1650327..1650697 1..371 100 -> Plus
arm_3R 1650758..1651166 372..780 100 -> Plus
arm_3R 1651221..1651310 781..870 100 -> Plus
arm_3R 1651527..1652298 871..1642 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:53:43 Download gff for GM01182.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5565436..5565806 1..371 100 -> Plus
3R 5565867..5566275 372..780 100 -> Plus
3R 5566330..5566419 781..870 100 -> Plus
3R 5566636..5567407 871..1642 100   Plus

GM01182.pep Sequence

Translation from 344 to 1303

> GM01182.pep
MSDSTIFRFNSSILDQSADSNVSSSSSNSSVSDSSVDSHSSIESNSGHNT
SVESQSSAESDSSADSHSSLERPSPVERDLSVESDSSSATNTSESSVGEA
SNQLQSPQSNNPLNMANLSVSTEDAHSQIRSLTQDVIQMEAELDRMNRYC
EEVVAQIDTFATRTSTPTTRRIRRRTSPVEVIDLSHLDRAPPVRSARNRD
PDAFIDLCTPEGPRSRTVNLHSNDSLTILPRRSAENDPVVDLDVASPPKR
VNRDIDESQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAIRATH
KCPICNKKLTARQFFRIYL*

GM01182.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16357-PA 202 GF16357-PA 16..202 131..319 589 60.5 Plus
Dana\GF14677-PA 326 GF14677-PA 157..326 143..319 357 45.1 Plus
Dana\GF15935-PA 116 GF15935-PA 31..116 239..319 210 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13065-PA 320 GG13065-PA 51..320 70..319 920 71.1 Plus
Dere\GG22477-PA 94 GG22477-PA 22..94 245..319 199 50.7 Plus
Dere\GG21725-PA 192 GG21725-PA 114..192 234..319 180 43 Plus
Dere\GG23586-PA 106 GG23586-PA 20..105 231..318 165 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22295-PA 202 GH22295-PA 84..202 166..319 271 37.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
dgrn-PA 319 CG10981-PA 1..319 1..319 1617 100 Plus
dgrn-PB 312 CG10981-PB 1..312 1..319 1566 97.8 Plus
dgrn-PD 205 CG10981-PD 1..205 115..319 1070 100 Plus
CG43058-PA 100 CG43058-PA 10..100 194..319 214 35.7 Plus
elfless-PC 229 CG15150-PC 42..229 156..319 183 30.7 Plus
elfless-PB 229 CG15150-PB 42..229 156..319 183 30.7 Plus
CG44271-PA 106 CG44271-PA 55..105 264..318 157 50.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21991-PA 294 GI21991-PA 68..294 123..319 385 43.2 Plus
Dmoj\GI14783-PA 374 GI14783-PA 319..374 264..319 222 62.5 Plus
Dmoj\GI13656-PA 254 GI13656-PA 199..254 264..319 218 58.9 Plus
Dmoj\GI15418-PA 707 GI15418-PA 651..707 264..319 182 50.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24328-PA 317 GL24328-PA 102..317 119..319 428 48.2 Plus
Dper\GL24317-PA 151 GL24317-PA 27..151 198..319 218 42.5 Plus
Dper\GL20345-PA 117 GL20345-PA 43..117 243..319 217 53.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10686-PB 326 GA10686-PB 111..326 119..319 437 49.1 Plus
Dpse\GA26569-PA 209 GA26569-PA 85..209 198..319 252 43.6 Plus
Dpse\GA28705-PA 209 GA28705-PA 85..209 198..319 242 42.9 Plus
Dpse\GA28704-PA 209 GA28704-PA 85..209 198..319 242 42.9 Plus
Dpse\GA28682-PA 138 GA28682-PA 14..138 198..319 238 44.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10845-PA 329 GM10845-PA 1..329 1..319 1162 83.3 Plus
Dsec\GM20261-PA 167 GM20261-PA 21..87 242..305 171 47.1 Plus
Dsec\GM13869-PA 91 GM13869-PA 5..91 231..319 158 39.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19827-PA 329 GD19827-PA 1..329 1..319 1165 83.3 Plus
Dsim\GD25747-PA 101 GD25747-PA 15..101 236..319 208 45.5 Plus
Dsim\GD22545-PA 91 GD22545-PA 17..91 240..319 154 40 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18825-PA 288 GJ18825-PA 175..288 197..319 254 44.1 Plus
Dvir\GJ13990-PA 303 GJ13990-PA 246..303 262..319 225 58.6 Plus
Dvir\GJ16377-PA 273 GJ16377-PA 153..273 205..319 191 39.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14441-PA 207 GK14441-PA 71..207 176..319 381 53.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10170-PA 344 GE10170-PA 1..344 1..319 947 66.9 Plus
Dyak\GE13346-PA 230 GE13346-PA 146..230 237..319 214 44.7 Plus
Dyak\GE13114-PA 239 GE13114-PA 171..239 247..319 181 46.6 Plus
Dyak\GE18407-PA 107 GE18407-PA 55..106 263..318 147 44.6 Plus

GM01182.hyp Sequence

Translation from 344 to 1303

> GM01182.hyp
MSDSTIFRFNSSILDQSADSNVSSSSSNSSVSDSSVDSHSSIESNSGHNT
SVESQSSAESDSSADSHSSLERPSPVERDLSVESDSSSATNTSESSVGEA
SNQLQSPQSNNPLNMANLSVSTEDAHSQIRSLTQDVIQMEAELDRMNRYC
EEVVAQIDTFATRTSTPTTRRIRRRTSPVEVIDLSHLDRAPPVRSARNRD
PDAFIDLCTPEGPRSRTVNLHSNDSLTILPRRSAENDPVVDLDVASPPKR
VNRDIDESQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAIRATH
KCPICNKKLTARQFFRIYL*

GM01182.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
dgrn-PA 319 CG10981-PA 1..319 1..319 1617 100 Plus
dgrn-PB 312 CG10981-PB 1..312 1..319 1566 97.8 Plus
dgrn-PD 205 CG10981-PD 1..205 115..319 1070 100 Plus
CG43058-PA 100 CG43058-PA 10..100 194..319 214 35.7 Plus
elfless-PC 229 CG15150-PC 42..229 156..319 183 30.7 Plus