Clone GM01344 Report

Search the DGRC for GM01344

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:13
Well:44
Vector:pBS SK-
Associated Gene/TranscriptCks85A-RA
Protein status:GM01344.pep: gold
Preliminary Size:818
Sequenced Size:616

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9790 2002-01-01 Sim4 clustering to Release 2
CG9790 2002-05-05 Blastp of sequenced clone
CG9790 2003-01-01 Sim4 clustering to Release 3
Cks85A 2008-04-29 Release 5.5 accounting
Cks85A 2008-08-15 Release 5.9 accounting
Cks85A 2008-12-18 5.12 accounting

Clone Sequence Records

GM01344.complete Sequence

616 bp (616 high quality bases) assembled on 2002-05-05

GenBank Submission: AY102666

> GM01344.complete
AATTTATTGACCTATTTTGGTAAAATTGCTTAATTTACCTCAGGTTTTCT
GGCTTTTCGCAATGCCGGCCGATCAAATTCAATACTCAGAGAAGTACTTC
GACGACAACTTTGAATACAGGCATGTTATCTTGCCACCGGATTTGGCCAA
ACATGTGCCGAAGGCTCATCTGATGACCGAGACGGAGTGGCGCAACCTGG
GCGTGCAGCAGAGCCCCGGCTGGGTGCACTACATGGTCCACGCGCCGGAG
CCGCATGTGATTCTATTCCGACGCAAACGCATTCCGGCAGAGGACGCTCC
ACAGGTGGCAGCCGCTAATGCGGCTCAGGCCATCGCGAATCTCTGCGGTT
AGGCGGAGGATGCCATGCCGCCGAGGAATGCTCTTCCAAGGACGCACTCG
TCAATGCTCACGTAGTATTTCATAAGTTAGCATCAGGCAGCCTGATGTAA
AATAAGAAACCATAGCTTTAGGGTTCAGCTGGGAAGTTCAAAGACACGAA
ACGAACTGAAGACATCGTTTCTGTTAATTTCATTAAGTTTATTTACCTAA
AATACAAATCGAAGCGTACGCCCTGTGTACAGACAGTTTAAAAAAAAAAA
AAAAAAAAAAAAAAAA

GM01344.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Cks85A-RA 727 Cks85A-RA 131..723 1..593 2965 100 Plus
Cks85A.a 619 Cks85A.a 70..619 44..593 2750 100 Plus
CG8112-RA 2097 CG8112-RA 2025..2097 593..521 365 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4541170..4541641 589..118 2330 99.6 Minus
chr3R 27901430 chr3R 4541708..4541828 121..1 605 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:13:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8715196..8715671 593..118 2380 100 Minus
3R 32079331 3R 8715738..8715858 121..1 605 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8456027..8456502 593..118 2380 100 Minus
3R 31820162 3R 8456569..8456689 121..1 605 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:34:55 has no hits.

GM01344.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:36:09 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4541709..4541828 1..120 100   Minus
chr3R 4541170..4541638 121..589 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:00:59 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 1..291 62..352 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:53:02 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 1..291 62..352 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:50:31 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 1..291 62..352 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:45:35 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 1..291 62..352 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:45 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 1..291 62..352 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:31:22 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 1..587 3..589 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:53:02 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 21..609 1..589 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:50:31 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 22..610 1..589 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:45:35 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 1..587 3..589 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:45 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
Cks85A-RA 22..610 1..589 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:36:09 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8715200..8715668 121..589 100 <- Minus
3R 8715739..8715858 1..120 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:36:09 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8715200..8715668 121..589 100 <- Minus
3R 8715739..8715858 1..120 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:36:09 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8715200..8715668 121..589 100 <- Minus
3R 8715739..8715858 1..120 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:50:31 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4540922..4541390 121..589 100 <- Minus
arm_3R 4541461..4541580 1..120 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:18:04 Download gff for GM01344.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8456031..8456499 121..589 100 <- Minus
3R 8456570..8456689 1..120 100   Minus

GM01344.hyp Sequence

Translation from 61 to 351

> GM01344.hyp
MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQ
SPGWVHYMVHAPEPHVILFRRKRIPAEDAPQVAAANAAQAIANLCG*

GM01344.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Cks85A-PC 96 CG9790-PC 1..96 1..96 522 100 Plus
Cks85A-PB 96 CG9790-PB 1..96 1..96 522 100 Plus
Cks85A-PA 96 CG9790-PA 1..96 1..96 522 100 Plus
Cks30A-PA 74 CG3738-PA 5..72 6..73 288 67.6 Plus

GM01344.pep Sequence

Translation from 61 to 351

> GM01344.pep
MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQ
SPGWVHYMVHAPEPHVILFRRKRIPAEDAPQVAAANAAQAIANLCG*

GM01344.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16842-PA 98 GF16842-PA 1..95 1..96 430 84.4 Plus
Dana\GF22718-PA 75 GF22718-PA 2..70 3..71 279 65.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17431-PA 96 GG17431-PA 1..96 1..96 513 100 Plus
Dere\GG25340-PA 74 GG25340-PA 2..70 3..71 281 66.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19019-PA 99 GH19019-PA 1..93 1..93 402 78.5 Plus
Dgri\GH13319-PA 75 GH13319-PA 2..70 3..71 281 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Cks85A-PC 96 CG9790-PC 1..96 1..96 522 100 Plus
Cks85A-PB 96 CG9790-PB 1..96 1..96 522 100 Plus
Cks85A-PA 96 CG9790-PA 1..96 1..96 522 100 Plus
Cks30A-PA 74 CG3738-PA 5..72 6..73 288 67.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22832-PA 93 GI22832-PA 1..92 1..95 391 76.8 Plus
Dmoj\GI12276-PA 75 GI12276-PA 2..70 3..71 291 69.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12136-PA 91 GL12136-PA 1..91 1..91 423 84.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22037-PA 91 GA22037-PA 1..91 1..91 423 84.6 Plus
Dpse\GA25305-PA 75 GA25305-PA 2..73 3..74 287 65.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26323-PA 96 GM26323-PA 1..96 1..96 508 99 Plus
Dsec\GM17424-PA 74 GM17424-PA 2..70 3..71 281 66.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23595-PA 74 GD23595-PA 2..70 3..71 281 66.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24587-PA 93 GJ24587-PA 1..93 1..96 389 78.1 Plus
Dvir\GJ17855-PA 75 GJ17855-PA 2..70 3..71 287 68.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11278-PA 99 GK11278-PA 1..99 1..96 413 77.8 Plus
Dwil\GK15078-PA 59 GK15078-PA 2..52 3..53 202 68.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24833-PA 96 GE24833-PA 1..96 1..96 507 99 Plus
Dyak\GE18832-PA 74 GE18832-PA 2..70 3..71 281 66.7 Plus