BDGP Sequence Production Resources |
Search the DGRC for GM01757
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 17 |
Well: | 57 |
Vector: | pBS SK- |
Associated Gene/Transcript | mRpL36-RA |
Protein status: | GM01757.pep: gold |
Preliminary Size: | 679 |
Sequenced Size: | 509 |
Gene | Date | Evidence |
---|---|---|
CG18767 | 2002-01-01 | Sim4 clustering to Release 2 |
CG18767 | 2002-05-05 | Blastp of sequenced clone |
CG18767 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL36 | 2008-04-29 | Release 5.5 accounting |
mRpL36 | 2008-08-15 | Release 5.9 accounting |
mRpL36 | 2008-12-18 | 5.12 accounting |
509 bp (509 high quality bases) assembled on 2002-05-05
GenBank Submission: AY102667
> GM01757.complete TTCAATCCAAAACAGAAAAAGATGTCCCTGGCTAGTAGAATACTGCAACA AGGTTCCCGCTTGTGGAATGGTCTCAGTGCCGCGCGTGGTTTCCACCTTC TCACCCGGCCGGCGGCTCCTGCAATTGTATCAATTCAAAGCTCGCAACTT GTGGCCGCCACAACTGGAATCTGTCAGACGTCGGGTCTGCTGACGCCTGG CTCCACTTTGGTCCAGCAGGTGGCGGGATTCAAGGTCAAGGGACGCCTGA AGCGACGCTGCAAGGACTGCTACATCGTGGTGCGCCAGGAGCGCGGTTAT GTCATCTGCCCCACGCATCCACGCCACAAGCAGATGTCGATGAAGAAGCG CGACTACAAGTCGTGGATCCTGACGCACGCCACCCAATCCAAGGAGCGCG GCTATTAGACCTAATTAGGCATTAATAAAAGCATTTCTTTAAATATGTTC ATAAATAAATAAAAGAAAAATAATCCAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL36-RA | 546 | mRpL36-RA | 68..545 | 1..478 | 2390 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8116625..8117081 | 476..20 | 2285 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8124582..8125040 | 478..20 | 2295 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8117682..8118140 | 478..20 | 2295 | 100 | Minus |
3R | 31820162 | 3R | 18347403..18347458 | 509..454 | 205 | 91 | Minus |
3L | 28103327 | 3L | 25778395..25778449 | 508..454 | 200 | 90.9 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8116645..8117079 | 22..456 | 100 | <- | Minus |
chr3L | 8117134..8117154 | 1..21 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 1..387 | 22..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 1..387 | 22..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 1..387 | 22..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 1..387 | 22..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 1..387 | 22..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 20..475 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL36-RA | 20..475 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8124604..8125038 | 22..456 | 100 | <- | Minus |
3L | 8125093..8125113 | 1..21 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8124604..8125038 | 22..456 | 100 | <- | Minus |
3L | 8125093..8125113 | 1..21 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8124604..8125038 | 22..456 | 100 | <- | Minus |
3L | 8125093..8125113 | 1..21 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8117704..8118138 | 22..456 | 100 | <- | Minus |
arm_3L | 8118193..8118213 | 1..21 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8117704..8118138 | 22..456 | 100 | <- | Minus |
3L | 8118193..8118213 | 1..21 | 100 | Minus |
Translation from 0 to 407
> GM01757.hyp FNPKQKKMSLASRILQQGSRLWNGLSAARGFHLLTRPAAPAIVSIQSSQL VAATTGICQTSGLLTPGSTLVQQVAGFKVKGRLKRRCKDCYIVVRQERGY VICPTHPRHKQMSMKKRDYKSWILTHATQSKERGY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL36-PA | 128 | CG18767-PA | 1..128 | 8..135 | 664 | 100 | Plus |
Translation from 21 to 407
> GM01757.pep MSLASRILQQGSRLWNGLSAARGFHLLTRPAAPAIVSIQSSQLVAATTGI CQTSGLLTPGSTLVQQVAGFKVKGRLKRRCKDCYIVVRQERGYVICPTHP RHKQMSMKKRDYKSWILTHATQSKERGY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10482-PA | 128 | GF10482-PA | 1..128 | 1..128 | 539 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14920-PA | 128 | GG14920-PA | 1..128 | 1..128 | 625 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15288-PA | 129 | GH15288-PA | 1..129 | 1..128 | 471 | 71.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL36-PA | 128 | CG18767-PA | 1..128 | 1..128 | 664 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11998-PA | 131 | GI11998-PA | 1..131 | 1..128 | 476 | 68.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22482-PA | 128 | GL22482-PA | 1..128 | 1..128 | 506 | 75.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15071-PA | 128 | GA15071-PA | 1..128 | 1..128 | 506 | 75.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24971-PA | 128 | GM24971-PA | 1..128 | 1..128 | 652 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13020-PA | 128 | GD13020-PA | 1..128 | 1..128 | 655 | 97.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13269-PA | 128 | GJ13269-PA | 1..128 | 1..128 | 475 | 67.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18918-PA | 130 | GK18918-PA | 1..130 | 1..128 | 448 | 68.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20373-PA | 127 | GE20373-PA | 1..127 | 1..128 | 618 | 93 | Plus |