Clone GM01757 Report

Search the DGRC for GM01757

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:17
Well:57
Vector:pBS SK-
Associated Gene/TranscriptmRpL36-RA
Protein status:GM01757.pep: gold
Preliminary Size:679
Sequenced Size:509

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18767 2002-01-01 Sim4 clustering to Release 2
CG18767 2002-05-05 Blastp of sequenced clone
CG18767 2003-01-01 Sim4 clustering to Release 3
mRpL36 2008-04-29 Release 5.5 accounting
mRpL36 2008-08-15 Release 5.9 accounting
mRpL36 2008-12-18 5.12 accounting

Clone Sequence Records

GM01757.complete Sequence

509 bp (509 high quality bases) assembled on 2002-05-05

GenBank Submission: AY102667

> GM01757.complete
TTCAATCCAAAACAGAAAAAGATGTCCCTGGCTAGTAGAATACTGCAACA
AGGTTCCCGCTTGTGGAATGGTCTCAGTGCCGCGCGTGGTTTCCACCTTC
TCACCCGGCCGGCGGCTCCTGCAATTGTATCAATTCAAAGCTCGCAACTT
GTGGCCGCCACAACTGGAATCTGTCAGACGTCGGGTCTGCTGACGCCTGG
CTCCACTTTGGTCCAGCAGGTGGCGGGATTCAAGGTCAAGGGACGCCTGA
AGCGACGCTGCAAGGACTGCTACATCGTGGTGCGCCAGGAGCGCGGTTAT
GTCATCTGCCCCACGCATCCACGCCACAAGCAGATGTCGATGAAGAAGCG
CGACTACAAGTCGTGGATCCTGACGCACGCCACCCAATCCAAGGAGCGCG
GCTATTAGACCTAATTAGGCATTAATAAAAGCATTTCTTTAAATATGTTC
ATAAATAAATAAAAGAAAAATAATCCAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

GM01757.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL36-RA 546 mRpL36-RA 68..545 1..478 2390 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8116625..8117081 476..20 2285 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:13:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8124582..8125040 478..20 2295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8117682..8118140 478..20 2295 100 Minus
3R 31820162 3R 18347403..18347458 509..454 205 91 Minus
3L 28103327 3L 25778395..25778449 508..454 200 90.9 Minus
Blast to na_te.dros performed on 2019-03-16 06:57:16 has no hits.

GM01757.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:58:18 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8116645..8117079 22..456 100 <- Minus
chr3L 8117134..8117154 1..21 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:01:21 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 1..387 22..408 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:53:04 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 1..387 22..408 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:18 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 1..387 22..408 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:45:36 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 1..387 22..408 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:23:26 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 1..387 22..408 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:31:23 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:53:04 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:18 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 20..475 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:45:36 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:23:26 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL36-RA 20..475 1..456 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:18 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8124604..8125038 22..456 100 <- Minus
3L 8125093..8125113 1..21 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:18 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8124604..8125038 22..456 100 <- Minus
3L 8125093..8125113 1..21 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:18 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8124604..8125038 22..456 100 <- Minus
3L 8125093..8125113 1..21 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:18 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8117704..8118138 22..456 100 <- Minus
arm_3L 8118193..8118213 1..21 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:18:06 Download gff for GM01757.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8117704..8118138 22..456 100 <- Minus
3L 8118193..8118213 1..21 100   Minus

GM01757.hyp Sequence

Translation from 0 to 407

> GM01757.hyp
FNPKQKKMSLASRILQQGSRLWNGLSAARGFHLLTRPAAPAIVSIQSSQL
VAATTGICQTSGLLTPGSTLVQQVAGFKVKGRLKRRCKDCYIVVRQERGY
VICPTHPRHKQMSMKKRDYKSWILTHATQSKERGY*

GM01757.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL36-PA 128 CG18767-PA 1..128 8..135 664 100 Plus

GM01757.pep Sequence

Translation from 21 to 407

> GM01757.pep
MSLASRILQQGSRLWNGLSAARGFHLLTRPAAPAIVSIQSSQLVAATTGI
CQTSGLLTPGSTLVQQVAGFKVKGRLKRRCKDCYIVVRQERGYVICPTHP
RHKQMSMKKRDYKSWILTHATQSKERGY*

GM01757.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10482-PA 128 GF10482-PA 1..128 1..128 539 78.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14920-PA 128 GG14920-PA 1..128 1..128 625 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15288-PA 129 GH15288-PA 1..129 1..128 471 71.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL36-PA 128 CG18767-PA 1..128 1..128 664 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11998-PA 131 GI11998-PA 1..131 1..128 476 68.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22482-PA 128 GL22482-PA 1..128 1..128 506 75.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15071-PA 128 GA15071-PA 1..128 1..128 506 75.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24971-PA 128 GM24971-PA 1..128 1..128 652 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13020-PA 128 GD13020-PA 1..128 1..128 655 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13269-PA 128 GJ13269-PA 1..128 1..128 475 67.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18918-PA 130 GK18918-PA 1..130 1..128 448 68.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20373-PA 127 GE20373-PA 1..127 1..128 618 93 Plus