Clone GM01885 Report

Search the DGRC for GM01885

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:18
Well:85
Vector:pBS SK-
Associated Gene/TranscriptMtap-RA
Protein status:GM01885.pep: gold
Preliminary Size:1380
Sequenced Size:1227

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4802 2001-01-01 Release 2 assignment
CG4802 2003-01-01 Sim4 clustering to Release 3
CG4802 2003-02-28 Blastp of sequenced clone
CG4802 2008-04-29 Release 5.5 accounting
CG4802 2008-08-15 Release 5.9 accounting
CG4802 2008-12-18 5.12 accounting

Clone Sequence Records

GM01885.complete Sequence

1227 bp (1227 high quality bases) assembled on 2003-02-28

GenBank Submission: BT004912

> GM01885.complete
GAACATTCTACTCTGCTCCAGACTGCCGCAACAGCAGCTTGTAAAAGCAC
AATCCTCCGCTAGCCATGATTACGATTAAATGTAAAGACACCAATCTGGA
CCCGCTTCCGGTCAAGATTGGTATTATTGGCGGTTCGGGGCTTGACGACC
CAGATATCCTGGAACAGCGGCAGGAACGTGTGGTGGAGACGCCCTACGGA
GAACCGTCTGATGCATTGATTGAAGGCGAGATCAATGGAGTACAGTGCGT
ACTCCTGGCGCGTCATGGACGCAAGCACGACATCATGCCCTCCAATGTTA
ACTACCGGGCCAACATCTGGGCTCTACGCGATGTGGGCTGCACCCACTTA
ATTGTCTCCACGGCATGTGGATCGTTGCGCGAGGAAATCAAGCCGGGCAA
CCTGGTTGTTCCACACGACTTTATCGACAGGACTACTAAACGCCTTCAGA
CCTTCTACGATGGCAAGGCACAAAGTCCACGTGGTGTTTGCCACCTGCCC
ATGTTTCCGGCATTCAGCGAACGCACCCGCAACATTCTGCTTCAGGCGGC
CAAGGAGCTGGAGATTCCCGCCCACGATAAGGCCACCATTGTGACTATTG
AGGGTCCGCGCTTCTCCTCTCGCTCGGAGAGCCACATGTTCCGTCAGTGG
GGCGGGGACCTCATAAACATGACCACGTGTCCAGAAGTGGTGCTAGCCAA
GGAGGCTGGCCTACTTTACGGGTCGGTGGCCATTGCCACGGACTACGACT
GCTGGCGCATGGGTTGCGAGGGTGTCAACGTGCAGGATGTCCTCCGTACT
TTTGCCGAGAACGTAATTAAGGTGAAGAAGATTCTGGTCAACGCTGTTGG
TCGAATTGCCAAGGAGGACTGGTCGGAGGACATACTAAATGCCAAGCAAT
GCGTTTGCAACAACACAATGTCTGGAGCCATGTGACGATTTATAAAACTT
TGCCACGAAATAACAGAAGAGACGCTGATTCGCCGCAAGATTTATGTGCC
ACCGCTCTATCAACAGTTCCACAAAAAGCGAGGACCCAGAGTTCACTCCA
TATCCATTACGTACGAATTAGATCCGAAAGACAAAAGGCAGCCGGTGAAA
ACTCCATTGAAATGTGAAACTGTAACGTCCGCGTCAGCGTCGCAGTAAAT
ATATACATATGTGTGTAACTAAAAACATTTCCGTAATCAAATGCAATCTA
TTCCTAAACAAAAAAAAAAAAAAAAAA

GM01885.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG4802-RA 1509 CG4802-RA 259..1470 1..1212 6060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13315226..13316007 115..896 3910 100 Plus
chr2R 21145070 chr2R 13316065..13316379 895..1209 1575 100 Plus
chr2R 21145070 chr2R 13315042..13315157 1..116 580 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:14:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17428162..17428943 115..896 3910 100 Plus
2R 25286936 2R 17429001..17429318 895..1212 1590 100 Plus
2R 25286936 2R 17427978..17428093 1..116 580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17429361..17430142 115..896 3910 100 Plus
2R 25260384 2R 17430200..17430517 895..1212 1590 100 Plus
2R 25260384 2R 17429177..17429292 1..116 580 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:56:51 has no hits.

GM01885.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:57:46 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13315042..13315157 1..116 100 -> Plus
chr2R 13315228..13316007 117..896 100 -> Plus
chr2R 13316067..13316379 897..1209 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:01:29 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
CG4802-RA 1..870 66..935 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:58 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
CG4802-RA 1..870 66..935 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:58:20 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
CG4802-RB 1..1083 66..1148 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:24 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
CG4802-RA 1..870 66..935 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:57:23 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
Mtap-RB 1..1083 66..1148 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:58:43 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
CG4802-RA 259..1463 1..1205 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:58 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
CG4802-RA 259..1463 1..1205 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:58:20 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
CG4802-RA 26..1234 1..1209 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:24 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
CG4802-RA 259..1463 1..1205 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:57:23 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
Mtap-RA 26..1234 1..1209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:46 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17427978..17428093 1..116 100 -> Plus
2R 17428164..17428943 117..896 100 -> Plus
2R 17429003..17429315 897..1209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:46 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17427978..17428093 1..116 100 -> Plus
2R 17428164..17428943 117..896 100 -> Plus
2R 17429003..17429315 897..1209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:46 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17427978..17428093 1..116 100 -> Plus
2R 17428164..17428943 117..896 100 -> Plus
2R 17429003..17429315 897..1209 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:58:20 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13315483..13315598 1..116 100 -> Plus
arm_2R 13315669..13316448 117..896 100 -> Plus
arm_2R 13316508..13316820 897..1209 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:08:41 Download gff for GM01885.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17429363..17430142 117..896 100 -> Plus
2R 17430202..17430514 897..1209 100   Plus
2R 17429177..17429292 1..116 100 -> Plus

GM01885.pep Sequence

Translation from 65 to 934

> GM01885.pep
MITIKCKDTNLDPLPVKIGIIGGSGLDDPDILEQRQERVVETPYGEPSDA
LIEGEINGVQCVLLARHGRKHDIMPSNVNYRANIWALRDVGCTHLIVSTA
CGSLREEIKPGNLVVPHDFIDRTTKRLQTFYDGKAQSPRGVCHLPMFPAF
SERTRNILLQAAKELEIPAHDKATIVTIEGPRFSSRSESHMFRQWGGDLI
NMTTCPEVVLAKEAGLLYGSVAIATDYDCWRMGCEGVNVQDVLRTFAENV
IKVKKILVNAVGRIAKEDWSEDILNAKQCVCNNTMSGAM*

GM01885.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13119-PA 289 GF13119-PA 1..289 1..289 1456 93.1 Plus
Dana\GF16421-PA 288 GF16421-PA 9..283 9..283 824 50.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20677-PA 289 GG20677-PA 1..289 1..289 1533 98.3 Plus
Dere\GG11348-PA 290 GG11348-PA 10..285 8..283 817 51.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21396-PA 289 GH21396-PA 1..289 1..289 1414 90.3 Plus
Dgri\GH22335-PA 284 GH22335-PA 8..269 16..277 839 56.9 Plus
Dgri\GH23773-PA 144 GH23773-PA 1..144 146..289 720 92.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Mtap-PC 289 CG4802-PC 1..289 1..289 1526 100 Plus
Mtap-PB 360 CG4802-PB 1..289 1..289 1526 100 Plus
Mtap-PA 289 CG4802-PA 1..289 1..289 1526 100 Plus
CG31115-PB 290 CG31115-PB 14..285 12..283 792 51.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18575-PA 289 GI18575-PA 1..289 1..289 1422 91 Plus
Dmoj\GI23974-PA 318 GI23974-PA 31..292 16..277 819 55 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11423-PA 289 GL11423-PA 1..289 1..289 1457 92.4 Plus
Dper\GL21888-PA 283 GL21888-PA 9..283 10..284 850 54.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18442-PA 289 GA18442-PA 1..289 1..289 1457 92.4 Plus
Dpse\GA16019-PA 288 GA16019-PA 9..282 10..283 858 54.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21772-PA 289 GM21772-PA 1..289 1..289 1541 99.3 Plus
Dsec\GM17788-PA 290 GM17788-PA 14..285 12..283 809 51.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11265-PA 289 GD11265-PA 1..289 1..289 1541 99.3 Plus
Dsim\GD21159-PA 290 GD21159-PA 14..279 12..277 794 51.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20369-PA 289 GJ20369-PA 1..289 1..289 1421 90.3 Plus
Dvir\GJ14133-PA 295 GJ14133-PA 11..272 16..277 861 57.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15951-PA 289 GK15951-PA 1..289 1..289 1454 91.3 Plus
Dwil\GK14359-PA 289 GK14359-PA 5..283 2..283 904 56.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11660-PA 289 GE11660-PA 1..289 1..289 1523 97.9 Plus
Dyak\GE23544-PA 285 GE23544-PA 10..279 8..277 804 51.9 Plus

GM01885.hyp Sequence

Translation from 65 to 934

> GM01885.hyp
MITIKCKDTNLDPLPVKIGIIGGSGLDDPDILEQRQERVVETPYGEPSDA
LIEGEINGVQCVLLARHGRKHDIMPSNVNYRANIWALRDVGCTHLIVSTA
CGSLREEIKPGNLVVPHDFIDRTTKRLQTFYDGKAQSPRGVCHLPMFPAF
SERTRNILLQAAKELEIPAHDKATIVTIEGPRFSSRSESHMFRQWGGDLI
NMTTCPEVVLAKEAGLLYGSVAIATDYDCWRMGCEGVNVQDVLRTFAENV
IKVKKILVNAVGRIAKEDWSEDILNAKQCVCNNTMSGAM*

GM01885.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Mtap-PC 289 CG4802-PC 1..289 1..289 1526 100 Plus
Mtap-PA 289 CG4802-PA 1..289 1..289 1526 100 Plus
Mtap-PB 360 CG4802-PB 1..289 1..289 1526 100 Plus
CG31115-PB 290 CG31115-PB 14..285 12..283 792 51.5 Plus