Clone GM02062 Report

Search the DGRC for GM02062

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:20
Well:62
Vector:pBS SK-
Associated Gene/TranscriptND23-RA
Protein status:GM02062.pep: gold
Preliminary Size:963
Sequenced Size:793

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3944 2001-01-01 Release 2 assignment
CG3944 2001-10-10 Blastp of sequenced clone
CG3944 2003-01-01 Sim4 clustering to Release 3
ND23 2008-04-29 Release 5.5 accounting
ND23 2008-08-15 Release 5.9 accounting
ND23 2008-12-18 5.12 accounting

Clone Sequence Records

GM02062.complete Sequence

793 bp (793 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060840

> GM02062.complete
AAACAACTTCTTTGGCAATTTTAGTTTAATTTGGTCGCAAAAATGTCGCT
AACTATGCGAATTTTCACCGCATCGCGCAACGGACAGCGCCTGTTTGGCA
GCCATGGAGCCCGGCTGCTGGCCGCCCAGCGAGCAGAACCCAAAGATATC
GTCGAGGTTCCCAAGGGCTATGTGTATGTAAACAACAAGGAACTGAGCAT
GGAGTTTGCCGACATCACGGACCGTGCTGCATCCACCATGTTCTTCGGTG
AACTCTTACGTGGATTTGCCGTCACCCTGGCGCACATCTTCAAGGAACCG
GCCACTATCAACTATCCCTTTGAAAAGGGACCACTGAGCCCGCGATTCCG
CGGAGAACATGCCCTTCGTCGTTATCCCAGTGGAGAGGAGCGCTGCATCG
CTTGCAAGCTATGCGAGGCTATTTGCCCCGCACAGGCGATCACCATCGAA
GCGGAGGAGCGCGCGGATGGCAGCAGACGTACCACACGCTACGATATCGA
CATGACCAAGTGCATCTACTGCGGATTCTGTCAGGAAGCCTGTCCCGTGG
ACGCCATCGTCGAGGGACCCAACTTCGAGTTCTCCACGGAGACGCACGAG
GAGCTGCTGTACAACAAGGAGAAGCTTCTCTGCAACGGCGACAAGTGGGA
GTCCGAGATTGCCTCTAACTTGCAGGCCGACCATCTCTATCGTTAAAGTT
GCTTGTACCCCTAGAATTCCTTGTTTAGAACGATTTTCCAATTAAAGATC
GTTGCTGTGGCTTCGTCTTAAGCGAAAAAAAAAAAAAAAAAAA

GM02062.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
ND23-RA 1038 ND23-RA 83..859 1..777 3885 100 Plus
ND23.a 1012 ND23.a 61..833 1..777 3800 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11660963..11661416 535..82 2240 99.6 Minus
chr3R 27901430 chr3R 11660656..11660897 774..533 1195 99.6 Minus
chr3R 27901430 chr3R 11661598..11661680 83..1 415 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:14:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15836354..15836807 535..82 2270 100 Minus
3R 32079331 3R 15836044..15836288 777..533 1225 100 Minus
3R 32079331 3R 15836989..15837071 83..1 415 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15577185..15577638 535..82 2270 100 Minus
3R 31820162 3R 15576875..15577119 777..533 1225 100 Minus
3R 31820162 3R 15577820..15577902 83..1 415 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:07:06 has no hits.

GM02062.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:08:15 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11660656..11660895 535..774 99 <- Minus
chr3R 11660964..11661415 83..534 99 <- Minus
chr3R 11661599..11661680 1..82 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:01:46 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 1..654 43..696 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:28 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 1..654 43..696 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:09:00 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 1..654 43..696 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:13 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 1..654 43..696 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:12:23 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 1..654 43..696 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:30 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 27..800 1..774 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:28 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 27..799 1..773 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:09:00 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 47..819 1..773 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:13 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 27..800 1..774 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:12:23 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
ND23-RA 47..819 1..773 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:15 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15836047..15836286 535..774 100 <- Minus
3R 15836355..15836806 83..534 100 <- Minus
3R 15836990..15837071 1..82 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:15 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15836047..15836286 535..774 100 <- Minus
3R 15836355..15836806 83..534 100 <- Minus
3R 15836990..15837071 1..82 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:15 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15836047..15836286 535..774 100 <- Minus
3R 15836355..15836806 83..534 100 <- Minus
3R 15836990..15837071 1..82 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:09:00 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11661769..11662008 535..774 100 <- Minus
arm_3R 11662077..11662528 83..534 100 <- Minus
arm_3R 11662712..11662793 1..82 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:08 Download gff for GM02062.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15576878..15577117 535..774 100 <- Minus
3R 15577186..15577637 83..534 100 <- Minus
3R 15577821..15577902 1..82 100   Minus

GM02062.hyp Sequence

Translation from 42 to 695

> GM02062.hyp
MSLTMRIFTASRNGQRLFGSHGARLLAAQRAEPKDIVEVPKGYVYVNNKE
LSMEFADITDRAASTMFFGELLRGFAVTLAHIFKEPATINYPFEKGPLSP
RFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRY
DIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLCNGD
KWESEIASNLQADHLYR*

GM02062.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
ND23-PA 217 CG3944-PA 1..217 1..217 1150 100 Plus

GM02062.pep Sequence

Translation from 42 to 695

> GM02062.pep
MSLTMRIFTASRNGQRLFGSHGARLLAAQRAEPKDIVEVPKGYVYVNNKE
LSMEFADITDRAASTMFFGELLRGFAVTLAHIFKEPATINYPFEKGPLSP
RFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRY
DIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLCNGD
KWESEIASNLQADHLYR*

GM02062.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16476-PA 217 GF16476-PA 1..217 1..217 1133 95.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20344-PA 217 GG20344-PA 1..217 1..217 1156 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18285-PA 217 GH18285-PA 1..217 1..217 1121 94.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
ND-23-PA 217 CG3944-PA 1..217 1..217 1150 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24093-PA 216 GI24093-PA 1..216 1..217 1074 92.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21733-PA 217 GL21733-PA 1..217 1..217 1101 94 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17794-PA 217 GA17794-PA 1..217 1..217 1101 94 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25751-PA 217 GM25751-PA 1..217 1..217 1160 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20325-PA 217 GD20325-PA 1..217 1..217 1157 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10912-PA 217 GJ10912-PA 1..217 1..217 1117 94.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14477-PA 217 GK14477-PA 1..217 1..217 1115 94.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26357-PA 217 GE26357-PA 1..217 1..217 1156 98.6 Plus