Clone GM02242 Report

Search the DGRC for GM02242

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:22
Well:42
Vector:pBS SK-
Associated Gene/TranscriptRpL17-RA
Protein status:GM02242.pep: gold
Preliminary Size:1029
Sequenced Size:885

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3203 2001-01-01 Release 2 assignment
CG3203 2001-10-10 Blastp of sequenced clone
CG14440 2003-01-01 Sim4 clustering to Release 3
RpL17 2008-04-29 Release 5.5 accounting
RpL17 2008-08-15 Release 5.9 accounting
RpL17 2008-12-18 5.12 accounting

Clone Sequence Records

GM02242.complete Sequence

885 bp (885 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060845

> GM02242.complete
CGTTTCCGGTGAGTGCATGTGCCTAGAAAGTTATTTTCCGAAAATTGCCA
CTTAAATCGTATTCAAACTCATTTATTTGTAGCCAAGGCACTGTGGTACG
TTTGCGGTCGTGTTAATGGTGTTTGCGGCGCAATTCTGGCTGGTGGAAAT
CAACACGTCGAATTGGCCGGCCAGAAAATGCGCTGACACCAAACCAATTC
ATTTTTTTTCTTACATATTTTTTTTACTGTGGGCCTGCGGGTCAAAACTG
AAAGATATTGAAAAATGGGCCGTTACTCACGCGAGTCAGACAACGTGGCC
AAGTCGTGCAAGGCGCGCGGGCCCAATCTACGTGTGCACTTCAAGAACAC
ACATGAGACCGCCCAGGCCATCAAGCGCATGCCCCTGCGCCGTGCCCAGC
GTTACCTGAAGGCCGTCATCGACCAGAAGGAGTGCGTGCCCTTCCGTCGC
TTCAACGGAGGAGTCGGTCGTTGTGCCCAGGCCAAGCAGTGGAAGACCAC
GCAGGGTCGCTGGCCCAAGAAGTCCGCCGAGTTCCTGTTGCAGCTGCTGC
GCAACGCCGAGGCCAACGCTGATTGCAAGGGTCTGGATGCCGACCGCCTG
GTCGTCCACCACATTCAGGTGAACCGCGCTCAGTGCCTGCGTCGCCGCAC
GTACCGTGCCCATGGTCGCATCAATCCCTACATGTCGTCGCCATGCCACG
TCGAGGTCATCCTCACCGAGAAGGAGGAGCTTGTCTCCAAGGCCACTGAT
GACGAGCCCGCCAAGAAGAAGCTCTCCAAGAAGAAGCTGCAGCGCCAAAA
GGAGAAGATGTTGCGTTCTGAATAAAATGTGTTCTGGGCCAGCCGCCCAA
GCCGGTGACAACTACTGAAAAAAAAAAAAAAAAAA

GM02242.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
RpL17-RD 1065 RpL17-RD 1..869 1..869 4330 99.8 Plus
RpL17-RC 1039 RpL17-RC 185..800 254..869 3065 99.8 Plus
RpL17-RA 880 RpL17-RA 70..684 255..869 3060 99.8 Plus
RpL17-RC 1039 RpL17-RC 91..185 1..95 475 100 Plus
RpL17-RA 880 RpL17-RA 12..78 1..67 305 97 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6633870..6634393 867..344 2620 100 Minus
chrX 22417052 chrX 6636086..6636339 254..1 1270 100 Minus
chrX 22417052 chrX 6635192..6635284 345..253 465 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:14:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6741733..6742258 869..344 2615 99.8 Minus
X 23542271 X 6743950..6744203 254..1 1270 100 Minus
X 23542271 X 6743058..6743150 345..253 465 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6749831..6750356 869..344 2615 99.8 Minus
X 23527363 X 6752048..6752301 254..1 1270 100 Minus
X 23527363 X 6751156..6751248 345..253 465 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:41:11 has no hits.

GM02242.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:42:11 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6633870..6634391 346..867 100 <- Minus
chrX 6635192..6635282 255..345 100 <- Minus
chrX 6636086..6636339 1..254 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:01:54 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RD 1..561 265..825 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:30 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RD 1..561 265..825 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:49 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RC 1..561 265..825 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:15 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RD 1..561 265..825 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:23:42 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RD 1..561 265..825 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:33 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RD 1..867 1..867 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:30 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RD 1..867 1..867 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:49 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RD 36..902 1..867 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:16 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RD 1..867 1..867 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:23:42 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
RpL17-RD 36..902 1..867 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:11 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
X 6741735..6742256 346..867 99 <- Minus
X 6743058..6743148 255..345 100 <- Minus
X 6743950..6744203 1..254 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:11 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
X 6741735..6742256 346..867 99 <- Minus
X 6743058..6743148 255..345 100 <- Minus
X 6743950..6744203 1..254 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:11 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
X 6741735..6742256 346..867 99 <- Minus
X 6743058..6743148 255..345 100 <- Minus
X 6743950..6744203 1..254 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:49 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6635768..6636289 346..867 99 <- Minus
arm_X 6637091..6637181 255..345 100 <- Minus
arm_X 6637983..6638236 1..254 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:11 Download gff for GM02242.complete
Subject Subject Range Query Range Percent Splice Strand
X 6749833..6750354 346..867 99 <- Minus
X 6751156..6751246 255..345 100 <- Minus
X 6752048..6752301 1..254 100   Minus

GM02242.hyp Sequence

Translation from 264 to 824

> GM02242.hyp
MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKA
VIDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEA
NADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVIL
TEKEELVSKATDDEPAKKKLSKKKLQRQKEKMLRSE*

GM02242.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
RpL17-PE 186 CG3203-PE 1..186 1..186 976 100 Plus
RpL17-PA 186 CG3203-PA 1..186 1..186 976 100 Plus
RpL17-PD 186 CG3203-PD 1..186 1..186 976 100 Plus
RpL17-PC 186 CG3203-PC 1..186 1..186 976 100 Plus
RpL17-PB 186 CG3203-PB 1..186 1..186 976 100 Plus

GM02242.pep Sequence

Translation from 264 to 824

> GM02242.pep
MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKA
VIDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEA
NADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVIL
TEKEELVSKATDDEPAKKKLSKKKLQRQKEKMLRSE*

GM02242.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21427-PA 186 GF21427-PA 1..186 1..186 977 97.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17658-PA 186 GG17658-PA 1..186 1..186 987 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12755-PA 186 GH12755-PA 1..186 1..186 889 94.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
RpL17-PE 186 CG3203-PE 1..186 1..186 976 100 Plus
RpL17-PA 186 CG3203-PA 1..186 1..186 976 100 Plus
RpL17-PD 186 CG3203-PD 1..186 1..186 976 100 Plus
RpL17-PC 186 CG3203-PC 1..186 1..186 976 100 Plus
RpL17-PB 186 CG3203-PB 1..186 1..186 976 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15202-PA 186 GI15202-PA 1..186 1..186 895 94.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26747-PA 303 GL26747-PA 119..303 2..186 973 97.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16622-PA 186 GA16622-PA 1..186 1..186 976 97.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12554-PA 186 GM12554-PA 1..186 1..186 993 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16610-PA 186 GJ16610-PA 1..186 1..186 892 94.1 Plus
Dvir\GJ20274-PA 186 GJ20274-PA 1..186 1..186 841 89.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16300-PA 186 GK16300-PA 1..186 1..186 895 94.1 Plus
Dwil\GK20261-PA 119 GK20261-PA 1..119 39..186 453 69.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16448-PA 186 GE16448-PA 1..186 1..186 987 98.9 Plus