Clone GM02245 Report

Search the DGRC for GM02245

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:22
Well:45
Vector:pBS SK-
Associated Gene/TranscriptCG34317-RA
Protein status:GM02245.pep2: gold GM02245.pep: full length peptide match
Preliminary Size:1347
Sequenced Size:1190

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7950 2001-01-01 Release 2 assignment
CG7950 2003-01-01 Sim4 clustering to Release 3
CG7950 2008-04-29 Release 5.5 accounting
CG34317 2008-08-15 Release 5.9 accounting
CG7950 2008-08-15 Release 5.9 accounting
CG7950 2008-12-18 5.12 accounting
CG34317 2008-12-18 5.12 accounting

Clone Sequence Records

GM02245.complete Sequence

1190 bp (1190 high quality bases) assembled on 2003-01-13

GenBank Submission: BT003292.1

> GM02245.complete
TCTGGCGGCGCACAGCTGTTTGAGAAGCAGAAAGAAACAGCAAAAAAGGG
GAGTAATTACATAAAAAAACACACTGACCGGCAACTTTTGGACGACTTTT
CCCGAAGATTCCGCCAAAAAAAGAGGGGCACTGGCACTTGCACCCAAAGC
ATGAGTGGTTACCAATATCTGGACGTGAAGATAAAACTCCGTGATCCAGA
CTCCGTGACTCTGACGCCCGTATTCTTCTGTGGCTGCATCCATAGCTCCT
TGGCTAGTATTTTTGGCGAAATAGGTGGCCAGACCATACTGGAAATTGTG
AAATTTAGTTCCAGCCAAAAACGCTCCATTCTCCGGGTGCCCGAGAACGT
CCTGGATCGCGTTCGCGTAGCTATAGCCCTAATAGGATACTACCAGGAGG
TGCCCTGCCATTTTCAGGTGCTCAGCACATCCCGAAAGCCCTTGGATTTT
GAGGAATCCCCCGAGGAGTTTGTAGCATTTAACTAGCATTACCGCATCAG
GATGTCATTCTCTTACTGCAAGGAGTACGGCAAGGACAAGGTGATCTTTG
TGACCAAGGAGGACCATGCCACGCCCAGCACCATCGAGCTGCCGCCGCCG
GAAAAGCCGGAGGGCGTGATCACCAAGGACGGCAAGATCAACTGGAGTTG
TCCCTGCCTCGGCGGCATGGCCACCGGTCCCTGTGGCGTCGATTTCCGTG
AGGCATTTTCCTGCTTCCAGAACAGCACCGCCGATCCCAAGGGATCGGAC
TGCTACGATGCCTTCACCAAGATGCGCGACTGTTTCCAGAAGTACCCCAC
CGTGTACAACAAATCTGGCGGTGATGACGACGACGATGATGGCTTGAGCG
AGGCCTTGGACACGGATGCCGGTTCAGTTGGTGGCCAGAACGCGGATCCG
CTGGCGGATGTGGGCAACAACGGAGGCGGCGATGAGCTGGTGTCCCCCAA
TAGCAGTTCAGTGGTTCCCAAGGCTTAGGTGGGAGTACATAAGATATGAG
CTAGGTGTGACTTCGTACAAAATAAATAAAACTTCATGAACTTCAATCCA
TCCCCACACTATCGATCGTGACTGGGAAACATTTATCAGCCAGATAGTCT
GGAATTAACAGAGATATTGTTGAAACAGCATAGTGCTTATTTCAGAAATA
AAAGATACTCGTTTTCTCAATTAAAAAAAAAAAAAAAAAA

GM02245.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34317-RA 1174 CG34317-RA 1..1174 2..1172 5715 99.4 Plus
CG7950-RA 1174 CG7950-RA 1..1174 2..1172 5715 99.4 Plus
CG7950-RB 1198 CG7950-RB 207..1198 183..1172 4845 99.3 Plus
CG7950-RB 1198 CG7950-RB 1..183 2..183 875 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25879555..25880546 183..1172 4835 99.4 Plus
chr3R 27901430 chr3R 25879267..25879449 1..182 865 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:14:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30057140..30058134 183..1175 4850 99.4 Plus
3R 32079331 3R 30056852..30057034 1..182 865 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29797971..29798965 183..1175 4860 99.3 Plus
3R 31820162 3R 29797683..29797865 1..182 875 99.4 Plus
Blast to na_te.dros performed on 2019-03-15 20:09:21 has no hits.

GM02245.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:10:31 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25879267..25879449 1..182 99 -> Plus
chr3R 25879555..25880546 183..1172 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:01:56 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG7950-RB 1..477 502..978 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:53 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG7950-RB 1..477 502..978 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:03:32 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG7950-RA 1..477 502..978 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:37 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG7950-RB 1..477 502..978 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:29:52 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG7950-RA 1..477 502..978 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:15:34 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 1..1174 2..1172 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:53 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 1..1174 2..1172 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:03:32 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 1..1168 8..1172 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:37 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 1..1174 2..1172 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:29:52 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 1..1168 8..1172 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:31 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30056852..30057034 1..182 99 -> Plus
3R 30057140..30058131 183..1172 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:31 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30056852..30057034 1..182 99 -> Plus
3R 30057140..30058131 183..1172 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:31 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30056852..30057034 1..182 99 -> Plus
3R 30057140..30058131 183..1172 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:03:32 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25882574..25882756 1..182 99 -> Plus
arm_3R 25882862..25883853 183..1172 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:21:08 Download gff for GM02245.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29797971..29798962 183..1172 99   Plus
3R 29797683..29797865 1..182 99 -> Plus

GM02245.pep Sequence

Translation from 0 to 485

> GM02245.pep
SGGAQLFEKQKETAKKGSNYIKKHTDRQLLDDFSRRFRQKKRGTGTCTQS
MSGYQYLDVKIKLRDPDSVTLTPVFFCGCIHSSLASIFGEIGGQTILEIV
KFSSSQKRSILRVPENVLDRVRVAIALIGYYQEVPCHFQVLSTSRKPLDF
EESPEEFVAFN*

GM02245.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18821-PA 101 GF18821-PA 1..101 51..151 357 66.3 Plus
Dana\GF18820-PA 74 GF18820-PA 1..70 51..122 171 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11731-PA 114 GG11731-PA 1..103 51..155 283 49.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19177-PA 241 GH19177-PA 1..84 51..134 246 53.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34317-PA 111 CG34317-PA 1..111 51..161 568 100 Plus
CG15526-PA 112 CG15526-PA 1..107 51..159 283 51.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24211-PA 113 GI24211-PA 1..102 51..152 342 59.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14027-PA 111 GL14027-PA 1..109 51..159 352 57.8 Plus
Dper\GL14026-PA 112 GL14026-PA 1..102 51..152 325 52.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26936-PA 111 GA26936-PA 1..109 51..159 353 58.7 Plus
Dpse\GA13784-PA 112 GA13784-PA 1..102 51..152 325 52.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12860-PA 111 GM12860-PA 1..111 51..161 556 93.7 Plus
Dsec\GM12859-PA 112 GM12859-PA 1..107 51..159 289 51.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21502-PA 111 GD21502-PA 1..111 51..161 556 93.7 Plus
Dsim\GD21501-PA 113 GD21501-PA 1..107 51..159 285 50.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10781-PA 120 GJ10781-PA 1..106 51..156 332 55.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13870-PA 114 GK13870-PA 1..111 51..161 358 60.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10857-PA 111 GE10857-PA 1..111 51..161 544 91.9 Plus
Dyak\GE10856-PA 114 GE10856-PA 1..103 51..155 285 50.5 Plus

GM02245.hyp Sequence

Translation from 501 to 977

> GM02245.hyp
MSFSYCKEYGKDKVIFVTKEDHATPSTIELPPPEKPEGVITKDGKINWSC
PCLGGMATGPCGVDFREAFSCFQNSTADPKGSDCYDAFTKMRDCFQKYPT
VYNKSGGDDDDDDGLSEALDTDAGSVGGQNADPLADVGNNGGGDELVSPN
SSSVVPKA*

GM02245.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG7950-PB 158 CG7950-PB 1..158 1..158 868 100 Plus
CG7950-PA 158 CG7950-PA 1..158 1..158 868 100 Plus

GM02245.pep2 Sequence

Translation from 501 to 977

> GM02245.pep2
MSFSYCKEYGKDKVIFVTKEDHATPSTIELPPPEKPEGVITKDGKINWSC
PCLGGMATGPCGVDFREAFSCFQNSTADPKGSDCYDAFTKMRDCFQKYPT
VYNKSGGDDDDDDGLSEALDTDAGSVGGQNADPLADVGNNGGGDELVSPN
SSSVVPKA*

GM02245.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18822-PA 153 GF18822-PA 1..152 3..157 576 75.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11732-PA 158 GG11732-PA 1..158 1..158 809 96.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19177-PA 241 GH19177-PA 81..201 5..125 459 74.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG7950-PB 158 CG7950-PB 1..158 1..158 868 100 Plus
CG7950-PA 158 CG7950-PA 1..158 1..158 868 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24212-PA 160 GI24212-PA 1..125 1..125 497 76 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14028-PA 161 GL14028-PA 1..160 1..158 516 70.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20713-PA 161 GA20713-PA 1..160 1..158 510 70 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12861-PA 158 GM12861-PA 1..158 1..158 823 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21503-PA 158 GD21503-PA 1..158 1..158 823 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10782-PA 159 GJ10782-PA 1..105 1..105 492 81.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13871-PA 149 GK13871-PA 1..137 3..134 496 70.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10858-PA 158 GE10858-PA 1..158 1..158 813 97.5 Plus