Clone GM02602 Report

Search the DGRC for GM02602

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:26
Well:2
Vector:pBS SK-
Associated Gene/TranscriptRbp1-RD
Protein status:GM02602.pep: gold
Preliminary Size:1657
Sequenced Size:1502

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17136 2001-01-01 Release 2 assignment
CG17136 2001-11-09 Blastp of sequenced clone
CG17136 2003-01-01 Sim4 clustering to Release 3
Rbp1 2008-04-29 Release 5.5 accounting
Rbp1 2008-08-15 Release 5.9 accounting
Rbp1 2008-12-18 5.12 accounting

Clone Sequence Records

GM02602.complete Sequence

1502 bp (1502 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069252

> GM02602.complete
AAAGGCGGAGATTTTTGTTAAAATTTTAACAAAATTGGATGACATTTTAG
AAGCCGCTTGCTCACCTCCCGCAATACTCACGATACCGCACCGCCCGACA
AAAATGCCGCGATATAGGGAGTGGGACTTGGCCTGCAAGGTGTACGTGGG
AAACCTGGGCTCCTCGGCGTCCAAGCACGAGATAGAAGGCGCATTTGCCA
AATATGGACCCCTGCGAAACGTGTGGGTGGCCCGCAATCCACCAGGTTTC
GCCTTTGTCGAATTTGAGGATCGCCGTGACGCGGAAGACGCAACGCGTGC
CCTGGACGGAACACGCTGCTGCGGCACCAGGATTCGCGTAGAGATGTCTT
CGGGTCGCTCGCGCGATCGCCGGCGCGGAGAAGGCGGCAGTAGTGGTCGC
TCTGGTTCCGGACGCTACAGGATAACTCCTTCGGCTAGAACTACTTCCAC
TGCTACTTCTTCCTTCTACAACATCAACAATCTACAACAGCAACCATCTT
CACAGCCACAGCCAGCAACCTTCAACTTGCAACTCTAAATTAACCATGTT
CAGCGTCACAGCCTCACAGAAGTTTTGATTAGCAACCCAAATGATTTCAT
CCTAGAAGAAGCAATGCAGTCGCCCAAAGAGTTCTTTTTTAAAGTTATCC
TGCGTATCCTTCAAATAATTGCTTACAATTATTTCTTTAATTTAGTTGCC
TATGATATGAGGGTTCGTCCGCTTTCTCAAGTACTTGACTCTGATGTCGA
GAAAACTGGCCTTGAACGCGTTTAACGCTGATGATCACAGCTACTATAGA
TTTGTTCGACCATTTTCTTATTGCATATGTATCCGACAAAGTAGAAAGCT
TTAAACTCTAATTATAGGATATCAGTTGGTAATAGATAGTAAATGTAATT
GCAGCAGCTAAATGTAATAGCAGCATTAGCAATAATACTCTTATCTTAAT
TGGTTCACAGCTTAATTCATAGAAACAAAACAGTTTGCACAGCTTTCATT
TTTGTTCCCCCTGGTAATTAGTTTAAGTAACTATTTAGCAGTATTTAACA
CTCCTATTTTGCAGCTCTTTGTAAGGCGCGTATGTACATACACTTCTTAC
CATTCTAAGCTGATTTAAATAATTTTATTAAGCTTTTAAGTAATCATTTC
TTCTTTACCAATGCGTTTATTTCAGGTCACGTTCGCCACGTCGCTCCCGA
TCGCCCCGCAGCCGCAGCTTCTCGCGCGATCGTCGAAGTCGCTCGGATTC
TCGGGATCGTCATTAATGTTTCCAAAAGGATATCGTTTAAGCAGTGTCGC
ATCAAAGAACAAGCCGGCCAAGGCCGTATTTTCTGTAGGAATTCCTATGT
CGATTGCGATCCAAGTAAATTTACTTCAGATGACAATATAAATCTTTCGA
TGCATTCTTGAAATTCCTTATTTTTTTACTAAAAAATAAAGACGCACAAT
CAGCGAGTTTTGATTGGTTTCATATATCATCAAAAAAAAAAAAAAAAAAA
AA

GM02602.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-RD 1600 Rbp1-RD 76..1563 1..1486 7355 99.7 Plus
Rbp1-RA 845 Rbp1-RA 76..496 1..421 2090 99.7 Plus
Rbp1-RC 762 Rbp1-RC 44..413 52..421 1835 99.7 Plus
Rbp1-RA 845 Rbp1-RA 493..808 1173..1486 1510 99 Plus
Rbp1-RC 762 Rbp1-RC 410..725 1173..1486 1510 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6610920..6611983 418..1481 5305 99.9 Plus
chr3R 27901430 chr3R 6610075..6610444 52..421 1850 100 Plus
chrX 22417052 chrX 13275219..13275464 348..103 480 79.7 Minus
chr3R 27901430 chr3R 6609948..6610000 1..53 265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:14:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10785400..10786470 418..1486 5275 99.7 Plus
3R 32079331 3R 10784555..10784924 52..421 1835 99.7 Plus
X 23542271 X 13384444..13384689 348..103 480 79.7 Minus
3R 32079331 3R 10784428..10784480 1..53 265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10526231..10527301 418..1486 5285 99.7 Plus
3R 31820162 3R 10525386..10525755 52..421 1835 99.7 Plus
X 23527363 X 13392542..13392787 348..103 480 79.6 Minus
3R 31820162 3R 10525259..10525311 1..53 265 100 Plus
X 23527363 X 13389055..13389113 1265..1207 145 83 Minus
Blast to na_te.dros performed on 2019-03-16 14:08:25 has no hits.

GM02602.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:09:33 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6609948..6610000 1..53 100 -> Plus
chr3R 6610077..6610443 54..420 100 -> Plus
chr3R 6610923..6611983 421..1481 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:02:09 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 1..435 104..538 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:29:14 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 1..435 104..538 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:26 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 1..435 104..538 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:56:49 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 1..435 104..538 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:28:02 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 1..435 104..538 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:06:41 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 30..1512 1..1481 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:29:13 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 30..1512 1..1481 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:26 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 46..1528 1..1481 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:56:49 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 30..1512 1..1481 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:28:02 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RD 46..1528 1..1481 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:33 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10784428..10784480 1..53 100 -> Plus
3R 10784557..10784923 54..420 99 -> Plus
3R 10785403..10786465 421..1481 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:33 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10784428..10784480 1..53 100 -> Plus
3R 10784557..10784923 54..420 99 -> Plus
3R 10785403..10786465 421..1481 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:33 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10784428..10784480 1..53 100 -> Plus
3R 10784557..10784923 54..420 99 -> Plus
3R 10785403..10786465 421..1481 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:26 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6610150..6610202 1..53 100 -> Plus
arm_3R 6610279..6610645 54..420 99 -> Plus
arm_3R 6611125..6612187 421..1481 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:33:03 Download gff for GM02602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10525388..10525754 54..420 99 -> Plus
3R 10526234..10527296 421..1481 99   Plus
3R 10525259..10525311 1..53 100 -> Plus

GM02602.hyp Sequence

Translation from 0 to 537

> GM02602.hyp
KAEIFVKILTKLDDILEAACSPPAILTIPHRPTKMPRYREWDLACKVYVG
NLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRA
LDGTRCCGTRIRVEMSSGRSRDRRRGEGGSSGRSGSGRYRITPSARTTST
ATSSFYNINNLQQQPSSQPQPATFNLQL*

GM02602.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-PD 144 CG17136-PD 1..144 35..178 761 100 Plus
Rbp1-PA 135 CG17136-PA 1..121 35..155 580 90.9 Plus
Rbp1-like-PB 247 CG1987-PB 1..142 35..152 490 69 Plus
Rbp1-like-PC 158 CG1987-PC 1..101 35..135 479 88.1 Plus
Rbp1-like-PA 158 CG1987-PA 1..101 35..135 479 88.1 Plus

GM02602.pep Sequence

Translation from 103 to 537

> GM02602.pep
MPRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFA
FVEFEDRRDAEDATRALDGTRCCGTRIRVEMSSGRSRDRRRGEGGSSGRS
GSGRYRITPSARTTSTATSSFYNINNLQQQPSSQPQPATFNLQL*

GM02602.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17902-PA 163 GF17902-PA 1..150 1..144 580 82 Plus
Dana\GF19500-PA 179 GF19500-PA 1..81 1..81 430 95.1 Plus
Dana\GF14123-PA 192 GF14123-PA 6..78 10..82 222 54.8 Plus
Dana\GF16525-PA 253 GF16525-PA 7..81 11..84 159 47.4 Plus
Dana\GF17608-PA 350 GF17608-PA 2..77 9..87 140 38 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17683-PA 144 GG17683-PA 1..144 1..144 761 100 Plus
Dere\GG19507-PA 159 GG19507-PA 1..81 1..81 422 95.1 Plus
Dere\GG23961-PA 200 GG23961-PA 9..81 10..82 224 54.8 Plus
Dere\GG20059-PA 255 GG20059-PA 7..78 11..81 157 47.2 Plus
Dere\GG19772-PA 135 GG19772-PA 2..77 9..87 137 38 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24472-PA 163 GH24472-PA 1..81 1..81 422 95.1 Plus
Dgri\GH13017-PA 201 GH13017-PA 6..78 10..82 224 54.8 Plus
Dgri\GH18077-PA 252 GH18077-PA 7..81 11..84 159 47.4 Plus
Dgri\GH18528-PA 360 GH18528-PA 2..77 9..87 139 38 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-PD 144 CG17136-PD 1..144 1..144 761 100 Plus
Rbp1-PA 135 CG17136-PA 1..121 1..121 580 90.9 Plus
Rbp1-like-PB 247 CG1987-PB 1..142 1..118 490 69 Plus
Rbp1-like-PC 158 CG1987-PC 1..101 1..101 479 88.1 Plus
Rbp1-like-PA 158 CG1987-PA 1..101 1..101 479 88.1 Plus
x16-PB 257 CG10203-PB 9..100 12..103 280 57.6 Plus
x16-PA 258 CG10203-PA 9..100 12..103 280 57.6 Plus
Rsf1-PB 200 CG5655-PB 11..136 12..123 258 46 Plus
Rsf1-PA 200 CG5655-PA 11..136 12..123 258 46 Plus
SF2-PB 255 CG6987-PB 7..107 11..101 165 41.6 Plus
SF2-PA 255 CG6987-PA 7..107 11..101 165 41.6 Plus
B52-PI 135 CG10851-PI 5..106 12..112 154 37.1 Plus
B52-PD 135 CG10851-PD 5..106 12..112 154 37.1 Plus
B52-PK 147 CG10851-PK 5..106 12..112 154 37.1 Plus
B52-PF 147 CG10851-PF 5..106 12..112 154 37.1 Plus
B52-PN 350 CG10851-PN 5..106 12..112 154 37.1 Plus
B52-PC 350 CG10851-PC 5..106 12..112 154 37.1 Plus
B52-PA 350 CG10851-PA 5..106 12..112 154 37.1 Plus
B52-PB 329 CG10851-PB 5..99 12..105 149 37.8 Plus
B52-PO 355 CG10851-PO 5..99 12..105 149 37.8 Plus
B52-PM 355 CG10851-PM 5..99 12..105 149 37.8 Plus
SC35-PD 195 CG5442-PD 27..139 15..115 148 35.4 Plus
SC35-PC 195 CG5442-PC 27..139 15..115 148 35.4 Plus
SC35-PB 195 CG5442-PB 27..139 15..115 148 35.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15337-PA 151 GI15337-PA 1..81 1..81 422 95.1 Plus
Dmoj\GI23736-PA 137 GI23736-PA 1..81 1..81 418 92.6 Plus
Dmoj\GI19446-PA 196 GI19446-PA 6..78 10..82 225 54.8 Plus
Dmoj\GI24651-PA 246 GI24651-PA 7..81 11..84 159 47.4 Plus
Dmoj\GI22065-PA 361 GI22065-PA 2..77 9..87 140 38 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26725-PA 174 GL26725-PA 1..81 1..81 423 95.1 Plus
Dper\GL18979-PA 196 GL18979-PA 9..110 10..110 252 52 Plus
Dper\GL22249-PA 263 GL22249-PA 7..81 11..84 160 47.4 Plus
Dper\GL23543-PA 358 GL23543-PA 2..77 9..87 140 38 Plus
Dper\GL12592-PA 154 GL12592-PA 29..123 10..99 136 33.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15173-PA 161 GA15173-PA 1..81 1..81 422 95.1 Plus
Dpse\GA30013-PA 259 GA30013-PA 9..82 12..85 257 63.5 Plus
Dpse\GA19037-PA 196 GA19037-PA 9..110 10..110 252 52 Plus
Dpse\GA20008-PA 263 GA20008-PA 7..81 11..84 160 47.4 Plus
Dpse\GA11577-PA 154 GA11577-PA 29..123 10..99 136 33.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23896-PA 144 GM23896-PA 1..144 1..144 761 100 Plus
Dsec\GM13734-PA 226 GM13734-PA 9..88 12..90 258 62.5 Plus
Dsec\GM11879-PA 200 GM11879-PA 9..81 10..82 224 54.8 Plus
Dsec\GM15444-PA 255 GM15444-PA 7..78 11..81 157 47.2 Plus
Dsec\GM24118-PA 135 GM24118-PA 2..77 9..87 137 38 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18708-PA 144 GD18708-PA 1..144 1..144 761 100 Plus
Dsim\GD22286-PA 200 GD22286-PA 9..81 10..82 224 54.8 Plus
Dsim\GD18917-PA 135 GD18917-PA 2..77 9..87 137 38 Plus
Dsim\GD19204-PA 154 GD19204-PA 29..123 10..99 135 33.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10582-PA 140 GJ10582-PA 1..89 1..89 451 93.3 Plus
Dvir\GJ14774-PA 155 GJ14774-PA 1..81 1..81 429 96.3 Plus
Dvir\GJ17527-PA 198 GJ17527-PA 6..78 10..82 224 54.8 Plus
Dvir\GJ23504-PA 247 GJ23504-PA 7..81 11..84 159 47.4 Plus
Dvir\GJ24113-PA 347 GJ24113-PA 2..77 9..87 139 38 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13897-PA 140 GK13897-PA 1..104 1..104 433 88.5 Plus
Dwil\GK16401-PA 176 GK16401-PA 1..81 1..81 428 95.1 Plus
Dwil\GK12439-PA 192 GK12439-PA 6..78 10..82 223 54.8 Plus
Dwil\GK13511-PA 263 GK13511-PA 7..78 11..81 157 47.2 Plus
Dwil\GK11244-PA 154 GK11244-PA 29..123 10..99 137 33.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26048-PA 135 GE26048-PA 1..81 1..81 442 100 Plus
Dyak\GE16161-PA 160 GE16161-PA 1..81 1..81 422 95.1 Plus
Dyak\GE26241-PA 200 GE26241-PA 9..81 10..82 224 54.8 Plus
Dyak\GE26323-PA 254 GE26323-PA 7..78 11..81 157 47.2 Plus
Dyak\GE26284-PA 135 GE26284-PA 2..77 9..87 137 38 Plus