Clone GM03174 Report

Search the DGRC for GM03174

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:31
Well:74
Vector:pBS SK-
Associated Gene/TranscriptRpb8-RA
Protein status:GM03174.pep: gold
Preliminary Size:889
Sequenced Size:696

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11246 2001-01-01 Release 2 assignment
CG11246 2001-10-10 Blastp of sequenced clone
CG11246 2003-01-01 Sim4 clustering to Release 3
Rpb8 2008-04-29 Release 5.5 accounting
Rpb8 2008-08-15 Release 5.9 accounting
Rpb8 2008-12-18 5.12 accounting

Clone Sequence Records

GM03174.complete Sequence

696 bp (696 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060855

> GM03174.complete
CTCATACTTAACACGCGCATGCAAAATATTTAAGAAATAAATATTAGTCG
CTAACAGTTTAAATATAATAAAATTCTGCTGATATAAACCCAGTTCATAA
AAGAACACGCATTTACCTCCGCATATAAGATCAAATACGTATAAAATCTA
ATTAGCCGACTCAAGTTAAAATGGCTGGAGTACTCTTTGAGGACATCTTC
AACGTAAAGGACATGGATCCGGAGGGCAAAAAGTTCGACCGTGTATCCCG
CCTGCACTGCGAGTCCGAGTCGTTTAAGATGGACCTCATCCTGGACATCA
ACTCGTGGCTATACCCCATGGAGCTGGGCGACAAGTTCCGCCTGGTTTTG
GCCACCACCCTGCGCGAGGATGGTTGCCCGGACAGCGGGGAGTACAATCC
AATGGAGCACGAGGGAACGCGGGCGGACAGCTTTGAGTACGTGATGTACG
GCAAGATCTACAGGATCGAGGGCGACGAAGCACACAATGAGGCCTCCCGG
CTCTCCGCCTACGTGTCATTCGGCGGCTTGCTGATGCGACTTCAGGGTGA
CGCCAACAATCTTCATGGCTTCGAGGTGGACCAGCACATGTACCTGCTGA
TGAAGCGGCTGGCCTTCTGAATTTTCTACCTAATTATTTTCGATCGCAAA
TTAGACATAGACAACAAACTTTAAAAAAAAAAAAAAAAAAAAAAAA

GM03174.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb8-RA 1019 Rpb8-RA 151..823 1..673 3365 100 Plus
Rpb8.a 1007 Rpb8.a 304..811 166..673 2540 100 Plus
Rpb8.a 1007 Rpb8.a 132..300 1..169 830 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21718121..21718629 164..672 2545 100 Plus
chr3L 24539361 chr3L 21717887..21718055 1..169 830 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:15:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21729186..21729695 164..673 2550 100 Plus
3L 28110227 3L 21728952..21729120 1..169 830 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21722286..21722795 164..673 2550 100 Plus
3L 28103327 3L 21722052..21722220 1..169 830 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 16:24:50 has no hits.

GM03174.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:25:28 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21717887..21718051 1..165 100 -> Plus
chr3L 21718123..21718629 166..672 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:02:35 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 1..450 171..620 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:02 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 1..450 171..620 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:56 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 1..450 171..620 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:50 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 1..450 171..620 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:26:57 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 1..450 171..620 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:12 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 9..680 1..672 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:02 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 9..680 1..672 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:56 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 21..692 1..672 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:50 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 9..680 1..672 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:26:57 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb8-RA 21..692 1..672 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:28 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21728952..21729116 1..165 100 -> Plus
3L 21729188..21729694 166..672 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:28 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21728952..21729116 1..165 100 -> Plus
3L 21729188..21729694 166..672 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:28 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21728952..21729116 1..165 100 -> Plus
3L 21729188..21729694 166..672 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:56 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21722052..21722216 1..165 100 -> Plus
arm_3L 21722288..21722794 166..672 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:45 Download gff for GM03174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21722288..21722794 166..672 100   Plus
3L 21722052..21722216 1..165 100 -> Plus

GM03174.pep Sequence

Translation from 170 to 619

> GM03174.pep
MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPM
ELGDKFRLVLATTLREDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIE
GDEAHNEASRLSAYVSFGGLLMRLQGDANNLHGFEVDQHMYLLMKRLAF*

GM03174.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25165-PA 149 GF25165-PA 1..149 1..149 788 99.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16218-PA 149 GG16218-PA 1..149 1..149 792 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15097-PA 149 GH15097-PA 1..149 1..149 789 99.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb8-PA 149 CG11246-PA 1..149 1..149 790 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13746-PA 149 GI13746-PA 1..149 1..149 789 99.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24857-PA 149 GL24857-PA 1..149 1..149 792 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10862-PA 149 GA10862-PA 1..149 1..149 792 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22401-PA 149 GM22401-PA 1..149 1..149 792 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14989-PA 149 GD14989-PA 1..149 1..149 792 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14092-PA 149 GJ14092-PA 1..149 1..149 789 99.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17059-PA 149 GK17059-PA 1..149 1..149 783 98 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19787-PA 149 GE19787-PA 1..149 1..149 792 100 Plus
Dyak\GE23031-PA 149 GE23031-PA 1..149 1..149 792 100 Plus

GM03174.hyp Sequence

Translation from 170 to 619

> GM03174.hyp
MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPM
ELGDKFRLVLATTLREDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIE
GDEAHNEASRLSAYVSFGGLLMRLQGDANNLHGFEVDQHMYLLMKRLAF*

GM03174.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb8-PA 149 CG11246-PA 1..149 1..149 790 100 Plus