BDGP Sequence Production Resources |
Search the DGRC for GM03174
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 31 |
Well: | 74 |
Vector: | pBS SK- |
Associated Gene/Transcript | Rpb8-RA |
Protein status: | GM03174.pep: gold |
Preliminary Size: | 889 |
Sequenced Size: | 696 |
Gene | Date | Evidence |
---|---|---|
CG11246 | 2001-01-01 | Release 2 assignment |
CG11246 | 2001-10-10 | Blastp of sequenced clone |
CG11246 | 2003-01-01 | Sim4 clustering to Release 3 |
Rpb8 | 2008-04-29 | Release 5.5 accounting |
Rpb8 | 2008-08-15 | Release 5.9 accounting |
Rpb8 | 2008-12-18 | 5.12 accounting |
696 bp (696 high quality bases) assembled on 2001-10-10
GenBank Submission: AY060855
> GM03174.complete CTCATACTTAACACGCGCATGCAAAATATTTAAGAAATAAATATTAGTCG CTAACAGTTTAAATATAATAAAATTCTGCTGATATAAACCCAGTTCATAA AAGAACACGCATTTACCTCCGCATATAAGATCAAATACGTATAAAATCTA ATTAGCCGACTCAAGTTAAAATGGCTGGAGTACTCTTTGAGGACATCTTC AACGTAAAGGACATGGATCCGGAGGGCAAAAAGTTCGACCGTGTATCCCG CCTGCACTGCGAGTCCGAGTCGTTTAAGATGGACCTCATCCTGGACATCA ACTCGTGGCTATACCCCATGGAGCTGGGCGACAAGTTCCGCCTGGTTTTG GCCACCACCCTGCGCGAGGATGGTTGCCCGGACAGCGGGGAGTACAATCC AATGGAGCACGAGGGAACGCGGGCGGACAGCTTTGAGTACGTGATGTACG GCAAGATCTACAGGATCGAGGGCGACGAAGCACACAATGAGGCCTCCCGG CTCTCCGCCTACGTGTCATTCGGCGGCTTGCTGATGCGACTTCAGGGTGA CGCCAACAATCTTCATGGCTTCGAGGTGGACCAGCACATGTACCTGCTGA TGAAGCGGCTGGCCTTCTGAATTTTCTACCTAATTATTTTCGATCGCAAA TTAGACATAGACAACAAACTTTAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21717887..21718051 | 1..165 | 100 | -> | Plus |
chr3L | 21718123..21718629 | 166..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 1..450 | 171..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 1..450 | 171..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 1..450 | 171..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 1..450 | 171..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 1..450 | 171..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 9..680 | 1..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 9..680 | 1..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 21..692 | 1..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 9..680 | 1..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb8-RA | 21..692 | 1..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21728952..21729116 | 1..165 | 100 | -> | Plus |
3L | 21729188..21729694 | 166..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21728952..21729116 | 1..165 | 100 | -> | Plus |
3L | 21729188..21729694 | 166..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21728952..21729116 | 1..165 | 100 | -> | Plus |
3L | 21729188..21729694 | 166..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21722052..21722216 | 1..165 | 100 | -> | Plus |
arm_3L | 21722288..21722794 | 166..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21722288..21722794 | 166..672 | 100 | Plus | |
3L | 21722052..21722216 | 1..165 | 100 | -> | Plus |
Translation from 170 to 619
> GM03174.pep MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPM ELGDKFRLVLATTLREDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIE GDEAHNEASRLSAYVSFGGLLMRLQGDANNLHGFEVDQHMYLLMKRLAF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25165-PA | 149 | GF25165-PA | 1..149 | 1..149 | 788 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16218-PA | 149 | GG16218-PA | 1..149 | 1..149 | 792 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15097-PA | 149 | GH15097-PA | 1..149 | 1..149 | 789 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb8-PA | 149 | CG11246-PA | 1..149 | 1..149 | 790 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13746-PA | 149 | GI13746-PA | 1..149 | 1..149 | 789 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24857-PA | 149 | GL24857-PA | 1..149 | 1..149 | 792 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10862-PA | 149 | GA10862-PA | 1..149 | 1..149 | 792 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22401-PA | 149 | GM22401-PA | 1..149 | 1..149 | 792 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14989-PA | 149 | GD14989-PA | 1..149 | 1..149 | 792 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14092-PA | 149 | GJ14092-PA | 1..149 | 1..149 | 789 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17059-PA | 149 | GK17059-PA | 1..149 | 1..149 | 783 | 98 | Plus |
Translation from 170 to 619
> GM03174.hyp MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPM ELGDKFRLVLATTLREDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIE GDEAHNEASRLSAYVSFGGLLMRLQGDANNLHGFEVDQHMYLLMKRLAF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb8-PA | 149 | CG11246-PA | 1..149 | 1..149 | 790 | 100 | Plus |