Clone GM03559 Report

Search the DGRC for GM03559

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:35
Well:59
Vector:pBS SK-
Associated Gene/TranscriptPdsw-RA
Protein status:GM03559.pep: gold
Preliminary Size:823
Sequenced Size:622

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8844 2001-01-01 Release 2 assignment
CG8844 2001-10-10 Blastp of sequenced clone
CG8844 2003-01-01 Sim4 clustering to Release 3
Pdsw 2008-04-29 Release 5.5 accounting
Pdsw 2008-08-15 Release 5.9 accounting
Pdsw 2008-12-18 5.12 accounting

Clone Sequence Records

GM03559.complete Sequence

622 bp (622 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060865

> GM03559.complete
GTCCTACAACAAATTTTAACACTTAGTTTTTCAAGTGGTAGGAGAGCCAG
AAAATGCCGGAACCGCGCAGTCCGATGGCCAGTTTTGCCGAGTCGGTGCT
GAATGTCATCGATGGACCCATAACTTGGTTCCGTGAGAGCATTGTGGAGC
CGAACCAGCAGAAGCAGAATTGGTACCACCAGCGCTTCCGCCGCGTTCCG
ACGATCGACCAGTGCTACACGGACGATGCCGTCTGCCGTTTCGAGGCCGA
TCAGCAGTTCCGCCGGGATCGCATGGTCGACAACGAGATTGTCAACATTC
TGCGCCAGCGCTTCGAGGACTGCACCCTCTACGAGGCACCCGATCACATG
GTCAAGTGCAGGCCGCTGATGGATCAGTACGAGAAGGCCACCGAGAACTG
GTTCATCAAGTATGGCGACTTGGGAGGTTATGCCAATGCCAAGACCGCGT
ACATGAAGCAGAAGCATCGTCTGATCTGGGAGCGTCGCCACGGACCAGTG
GGCAGTGGCATGAAGGAGGAGGCCGCCCACTAAACTCCGCTTTTATGATG
ATGTTTTCTAGTTTCATTATCCGTTAAAACAAAATATACACGCCGTAAAA
CGATAAAAAAAAAAAAAAAAAA

GM03559.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Pdsw-RA 776 Pdsw-RA 82..686 1..605 2950 99.1 Plus
Pdsw-RB 840 Pdsw-RB 180..750 35..605 2780 99.1 Plus
Pdsw.a 742 Pdsw.a 88..658 35..605 2780 99.1 Plus
Pdsw-RB 840 Pdsw-RB 59..94 1..36 180 100 Plus
Pdsw.a 742 Pdsw.a 36..69 1..34 170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3466370..3466646 135..411 1385 100 Plus
chr2L 23010047 chr2L 3466717..3466909 412..604 935 99 Plus
chr2L 23010047 chr2L 3465900..3466000 35..135 505 100 Plus
chr2L 23010047 chr2L 3465779..3465814 1..36 180 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:15:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3466786..3467062 135..411 1385 100 Plus
2L 23513712 2L 3467133..3467326 412..605 895 97.4 Plus
2L 23513712 2L 3466316..3466416 35..135 505 100 Plus
2L 23513712 2L 3466195..3466230 1..36 180 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3466786..3467062 135..411 1385 100 Plus
2L 23513712 2L 3467133..3467326 412..605 895 97.4 Plus
2L 23513712 2L 3466316..3466416 35..135 505 100 Plus
2L 23513712 2L 3466195..3466230 1..36 180 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:56:11 has no hits.

GM03559.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:57:09 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3465779..3465812 1..34 100 -> Plus
chr2L 3465900..3466000 35..135 100 -> Plus
chr2L 3466371..3466646 136..411 100 -> Plus
chr2L 3466717..3466909 412..604 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:02:48 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RB 1..480 54..533 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:05 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RB 1..480 54..533 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:46:09 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RA 1..480 54..533 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:53 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RB 1..480 54..533 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:51:43 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RA 1..480 54..533 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:15 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RA 34..637 1..604 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:05 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RA 34..637 1..604 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:46:09 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RA 39..642 1..604 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:53 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RA 34..637 1..604 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:51:43 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
Pdsw-RA 39..642 1..604 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:09 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3466195..3466228 1..34 100 -> Plus
2L 3466316..3466416 35..135 100 -> Plus
2L 3466787..3467062 136..411 100 -> Plus
2L 3467133..3467325 412..604 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:09 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3466195..3466228 1..34 100 -> Plus
2L 3466316..3466416 35..135 100 -> Plus
2L 3466787..3467062 136..411 100 -> Plus
2L 3467133..3467325 412..604 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:09 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3466195..3466228 1..34 100 -> Plus
2L 3466316..3466416 35..135 100 -> Plus
2L 3466787..3467062 136..411 100 -> Plus
2L 3467133..3467325 412..604 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:46:09 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3466195..3466228 1..34 100 -> Plus
arm_2L 3466316..3466416 35..135 100 -> Plus
arm_2L 3466787..3467062 136..411 100 -> Plus
arm_2L 3467133..3467325 412..604 97   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:47 Download gff for GM03559.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3466787..3467062 136..411 100 -> Plus
2L 3467133..3467325 412..604 97   Plus
2L 3466195..3466228 1..34 100 -> Plus
2L 3466316..3466416 35..135 100 -> Plus

GM03559.hyp Sequence

Translation from 53 to 532

> GM03559.hyp
MPEPRSPMASFAESVLNVIDGPITWFRESIVEPNQQKQNWYHQRFRRVPT
IDQCYTDDAVCRFEADQQFRRDRMVDNEIVNILRQRFEDCTLYEAPDHMV
KCRPLMDQYEKATENWFIKYGDLGGYANAKTAYMKQKHRLIWERRHGPVG
SGMKEEAAH*

GM03559.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Pdsw-PB 159 CG8844-PB 1..159 1..159 875 100 Plus
Pdsw-PA 159 CG8844-PA 1..159 1..159 875 100 Plus

GM03559.pep Sequence

Translation from 53 to 532

> GM03559.pep
MPEPRSPMASFAESVLNVIDGPITWFRESIVEPNQQKQNWYHQRFRRVPT
IDQCYTDDAVCRFEADQQFRRDRMVDNEIVNILRQRFEDCTLYEAPDHMV
KCRPLMDQYEKATENWFIKYGDLGGYANAKTAYMKQKHRLIWERRHGPVG
SGMKEEAAH*

GM03559.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15236-PA 159 GF15236-PA 1..159 1..159 830 94.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24945-PA 159 GG24945-PA 1..159 1..159 849 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10213-PA 160 GH10213-PA 1..156 1..156 810 92.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
ND-PDSW-PB 159 CG8844-PB 1..159 1..159 875 100 Plus
ND-PDSW-PA 159 CG8844-PA 1..159 1..159 875 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14985-PA 162 GI14985-PA 1..156 1..156 793 90.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18653-PA 157 GL18653-PA 1..156 1..156 801 91 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21363-PA 157 GA21363-PA 1..156 1..156 801 91 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11140-PA 159 GM11140-PA 1..159 1..159 869 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23234-PA 154 GD23234-PA 7..154 12..159 730 91.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17237-PA 161 GJ17237-PA 1..156 1..156 801 91.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23722-PA 161 GK23722-PA 1..161 1..159 799 88.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18236-PA 159 GE18236-PA 1..159 1..159 859 98.7 Plus