BDGP Sequence Production Resources |
Search the DGRC for GM03559
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 35 |
Well: | 59 |
Vector: | pBS SK- |
Associated Gene/Transcript | Pdsw-RA |
Protein status: | GM03559.pep: gold |
Preliminary Size: | 823 |
Sequenced Size: | 622 |
Gene | Date | Evidence |
---|---|---|
CG8844 | 2001-01-01 | Release 2 assignment |
CG8844 | 2001-10-10 | Blastp of sequenced clone |
CG8844 | 2003-01-01 | Sim4 clustering to Release 3 |
Pdsw | 2008-04-29 | Release 5.5 accounting |
Pdsw | 2008-08-15 | Release 5.9 accounting |
Pdsw | 2008-12-18 | 5.12 accounting |
622 bp (622 high quality bases) assembled on 2001-10-10
GenBank Submission: AY060865
> GM03559.complete GTCCTACAACAAATTTTAACACTTAGTTTTTCAAGTGGTAGGAGAGCCAG AAAATGCCGGAACCGCGCAGTCCGATGGCCAGTTTTGCCGAGTCGGTGCT GAATGTCATCGATGGACCCATAACTTGGTTCCGTGAGAGCATTGTGGAGC CGAACCAGCAGAAGCAGAATTGGTACCACCAGCGCTTCCGCCGCGTTCCG ACGATCGACCAGTGCTACACGGACGATGCCGTCTGCCGTTTCGAGGCCGA TCAGCAGTTCCGCCGGGATCGCATGGTCGACAACGAGATTGTCAACATTC TGCGCCAGCGCTTCGAGGACTGCACCCTCTACGAGGCACCCGATCACATG GTCAAGTGCAGGCCGCTGATGGATCAGTACGAGAAGGCCACCGAGAACTG GTTCATCAAGTATGGCGACTTGGGAGGTTATGCCAATGCCAAGACCGCGT ACATGAAGCAGAAGCATCGTCTGATCTGGGAGCGTCGCCACGGACCAGTG GGCAGTGGCATGAAGGAGGAGGCCGCCCACTAAACTCCGCTTTTATGATG ATGTTTTCTAGTTTCATTATCCGTTAAAACAAAATATACACGCCGTAAAA CGATAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pdsw-RA | 776 | Pdsw-RA | 82..686 | 1..605 | 2950 | 99.1 | Plus |
Pdsw-RB | 840 | Pdsw-RB | 180..750 | 35..605 | 2780 | 99.1 | Plus |
Pdsw.a | 742 | Pdsw.a | 88..658 | 35..605 | 2780 | 99.1 | Plus |
Pdsw-RB | 840 | Pdsw-RB | 59..94 | 1..36 | 180 | 100 | Plus |
Pdsw.a | 742 | Pdsw.a | 36..69 | 1..34 | 170 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 3466370..3466646 | 135..411 | 1385 | 100 | Plus |
chr2L | 23010047 | chr2L | 3466717..3466909 | 412..604 | 935 | 99 | Plus |
chr2L | 23010047 | chr2L | 3465900..3466000 | 35..135 | 505 | 100 | Plus |
chr2L | 23010047 | chr2L | 3465779..3465814 | 1..36 | 180 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 3466786..3467062 | 135..411 | 1385 | 100 | Plus |
2L | 23513712 | 2L | 3467133..3467326 | 412..605 | 895 | 97.4 | Plus |
2L | 23513712 | 2L | 3466316..3466416 | 35..135 | 505 | 100 | Plus |
2L | 23513712 | 2L | 3466195..3466230 | 1..36 | 180 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 3466786..3467062 | 135..411 | 1385 | 100 | Plus |
2L | 23513712 | 2L | 3467133..3467326 | 412..605 | 895 | 97.4 | Plus |
2L | 23513712 | 2L | 3466316..3466416 | 35..135 | 505 | 100 | Plus |
2L | 23513712 | 2L | 3466195..3466230 | 1..36 | 180 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 3465779..3465812 | 1..34 | 100 | -> | Plus |
chr2L | 3465900..3466000 | 35..135 | 100 | -> | Plus |
chr2L | 3466371..3466646 | 136..411 | 100 | -> | Plus |
chr2L | 3466717..3466909 | 412..604 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RB | 1..480 | 54..533 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RB | 1..480 | 54..533 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RA | 1..480 | 54..533 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RB | 1..480 | 54..533 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RA | 1..480 | 54..533 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RA | 34..637 | 1..604 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RA | 34..637 | 1..604 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RA | 39..642 | 1..604 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RA | 34..637 | 1..604 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdsw-RA | 39..642 | 1..604 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3466195..3466228 | 1..34 | 100 | -> | Plus |
2L | 3466316..3466416 | 35..135 | 100 | -> | Plus |
2L | 3466787..3467062 | 136..411 | 100 | -> | Plus |
2L | 3467133..3467325 | 412..604 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3466195..3466228 | 1..34 | 100 | -> | Plus |
2L | 3466316..3466416 | 35..135 | 100 | -> | Plus |
2L | 3466787..3467062 | 136..411 | 100 | -> | Plus |
2L | 3467133..3467325 | 412..604 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3466195..3466228 | 1..34 | 100 | -> | Plus |
2L | 3466316..3466416 | 35..135 | 100 | -> | Plus |
2L | 3466787..3467062 | 136..411 | 100 | -> | Plus |
2L | 3467133..3467325 | 412..604 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 3466195..3466228 | 1..34 | 100 | -> | Plus |
arm_2L | 3466316..3466416 | 35..135 | 100 | -> | Plus |
arm_2L | 3466787..3467062 | 136..411 | 100 | -> | Plus |
arm_2L | 3467133..3467325 | 412..604 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3466787..3467062 | 136..411 | 100 | -> | Plus |
2L | 3467133..3467325 | 412..604 | 97 | Plus | |
2L | 3466195..3466228 | 1..34 | 100 | -> | Plus |
2L | 3466316..3466416 | 35..135 | 100 | -> | Plus |
Translation from 53 to 532
> GM03559.hyp MPEPRSPMASFAESVLNVIDGPITWFRESIVEPNQQKQNWYHQRFRRVPT IDQCYTDDAVCRFEADQQFRRDRMVDNEIVNILRQRFEDCTLYEAPDHMV KCRPLMDQYEKATENWFIKYGDLGGYANAKTAYMKQKHRLIWERRHGPVG SGMKEEAAH*
Translation from 53 to 532
> GM03559.pep MPEPRSPMASFAESVLNVIDGPITWFRESIVEPNQQKQNWYHQRFRRVPT IDQCYTDDAVCRFEADQQFRRDRMVDNEIVNILRQRFEDCTLYEAPDHMV KCRPLMDQYEKATENWFIKYGDLGGYANAKTAYMKQKHRLIWERRHGPVG SGMKEEAAH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15236-PA | 159 | GF15236-PA | 1..159 | 1..159 | 830 | 94.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24945-PA | 159 | GG24945-PA | 1..159 | 1..159 | 849 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10213-PA | 160 | GH10213-PA | 1..156 | 1..156 | 810 | 92.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ND-PDSW-PB | 159 | CG8844-PB | 1..159 | 1..159 | 875 | 100 | Plus |
ND-PDSW-PA | 159 | CG8844-PA | 1..159 | 1..159 | 875 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14985-PA | 162 | GI14985-PA | 1..156 | 1..156 | 793 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18653-PA | 157 | GL18653-PA | 1..156 | 1..156 | 801 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21363-PA | 157 | GA21363-PA | 1..156 | 1..156 | 801 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11140-PA | 159 | GM11140-PA | 1..159 | 1..159 | 869 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23234-PA | 154 | GD23234-PA | 7..154 | 12..159 | 730 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17237-PA | 161 | GJ17237-PA | 1..156 | 1..156 | 801 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23722-PA | 161 | GK23722-PA | 1..161 | 1..159 | 799 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18236-PA | 159 | GE18236-PA | 1..159 | 1..159 | 859 | 98.7 | Plus |