BDGP Sequence Production Resources |
Search the DGRC for GM03767
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 37 |
Well: | 67 |
Vector: | pBS SK- |
Associated Gene/Transcript | mRpL12-RA |
Protein status: | GM03767.pep: gold |
Preliminary Size: | 886 |
Sequenced Size: | 693 |
Gene | Date | Evidence |
---|---|---|
CG5012 | 2001-01-01 | Release 2 assignment |
CG5012 | 2001-10-10 | Blastp of sequenced clone |
CG5012 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL12 | 2008-04-29 | Release 5.5 accounting |
mRpL12 | 2008-08-15 | Release 5.9 accounting |
mRpL12 | 2008-12-18 | 5.12 accounting |
693 bp (693 high quality bases) assembled on 2001-10-10
GenBank Submission: AY060871
> GM03767.complete CCCAAAGAATTTATTTTGTCACCCGAAAACCATACCAATAAGATGCACAT CACACGCCTCGCCCTTCGCCAGATTTCGCGCCAAGTGCAGCTGCATCGCA TGTACAGTGCAGCGGCTCCGGCCGCCGCAGTCTCGGGTGCGGAAAAACTG GTGCCTCCCGCGCCGGAAGGAGCCGCCAAGCCACCCAATCCCAAACTGGA CTCGATTGTCAACAACATTGCCGCGCTCAATCTCCTCGAGGTGGCCGAGC TGAGCACCCTGCTCAAACAGAAACTGAACCTGCCCGAGACCGCATTTGCC CCACAATTCGCCGCTGGGCCGGCACGTGCTGCTCCCGCCGAGGATGAGGA GGAGGCAGCGCCCAAGAAGGTACAGACCTCCTTCAAGGTCAAGCTGGTCA AGTTCGACGAAAAGCAGAAGGTGGCGCTGATCAAGGAGGTGAAGAACCTA CTCGAGGGCATGAACCTGGTGCAGGCCAAAAAGTTCGTCGAGAGCGCACC GACCATCGTTAAGGAGGACATCCCCAAGGAGGAGGCCGAGAAACTCAAGG AGGCACTGTCCAAGGCGGGCGCCATCATCGAGATCGAGTAGGATCGGCCA CGGTGCCTTCGTTTATCCACTTTGCGTTTAGCTGCTAGTTACTGTTTTAA TAAAAAGCCAGGCAACATTTGCTGTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL12-RA | 1008 | mRpL12-RA | 121..798 | 1..678 | 3390 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8948978..8949621 | 32..675 | 3220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8956936..8957582 | 32..678 | 3235 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
G5 | 4856 | G5 G5_DM 4856bp | 567..652 | 491..409 | 117 | 61.6 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8948891..8948921 | 1..31 | 100 | -> | Plus |
chr3L | 8948978..8949621 | 32..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 1..549 | 43..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 58..732 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 58..732 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 59..733 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 58..732 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL12-RA | 59..733 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8956849..8956879 | 1..31 | 100 | -> | Plus |
3L | 8956936..8957579 | 32..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8956849..8956879 | 1..31 | 100 | -> | Plus |
3L | 8956936..8957579 | 32..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8956849..8956879 | 1..31 | 100 | -> | Plus |
3L | 8956936..8957579 | 32..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8949949..8949979 | 1..31 | 100 | -> | Plus |
arm_3L | 8950036..8950679 | 32..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8950036..8950679 | 32..675 | 100 | Plus | |
3L | 8949949..8949979 | 1..31 | 100 | -> | Plus |
Translation from 0 to 590
> GM03767.hyp PKEFILSPENHTNKMHITRLALRQISRQVQLHRMYSAAAPAAAVSGAEKL VPPAPEGAAKPPNPKLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFA PQFAAGPARAAPAEDEEEAAPKKVQTSFKVKLVKFDEKQKVALIKEVKNL LEGMNLVQAKKFVESAPTIVKEDIPKEEAEKLKEALSKAGAIIEIE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL12-PA | 182 | CG5012-PA | 1..182 | 15..196 | 885 | 100 | Plus |
Translation from 42 to 590
> GM03767.pep MHITRLALRQISRQVQLHRMYSAAAPAAAVSGAEKLVPPAPEGAAKPPNP KLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFAPQFAAGPARAAPAE DEEEAAPKKVQTSFKVKLVKFDEKQKVALIKEVKNLLEGMNLVQAKKFVE SAPTIVKEDIPKEEAEKLKEALSKAGAIIEIE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24365-PA | 181 | GF24365-PA | 1..181 | 1..182 | 746 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14359-PA | 182 | GG14359-PA | 1..182 | 1..182 | 891 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15337-PA | 182 | GH15337-PA | 1..182 | 1..182 | 613 | 83.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL12-PA | 182 | CG5012-PA | 1..182 | 1..182 | 885 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12941-PA | 182 | GI12941-PA | 1..182 | 1..182 | 686 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20728-PA | 181 | GL20728-PA | 1..181 | 1..182 | 686 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18594-PA | 181 | GA18594-PA | 1..181 | 1..182 | 682 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25104-PA | 182 | GM25104-PA | 1..182 | 1..182 | 896 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14139-PA | 182 | GD14139-PA | 1..182 | 1..182 | 901 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13083-PA | 182 | GJ13083-PA | 1..182 | 1..182 | 652 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16748-PA | 183 | GK16748-PA | 1..183 | 1..182 | 748 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20790-PA | 182 | GE20790-PA | 1..182 | 1..182 | 883 | 97.3 | Plus |