Clone GM03767 Report

Search the DGRC for GM03767

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:37
Well:67
Vector:pBS SK-
Associated Gene/TranscriptmRpL12-RA
Protein status:GM03767.pep: gold
Preliminary Size:886
Sequenced Size:693

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5012 2001-01-01 Release 2 assignment
CG5012 2001-10-10 Blastp of sequenced clone
CG5012 2003-01-01 Sim4 clustering to Release 3
mRpL12 2008-04-29 Release 5.5 accounting
mRpL12 2008-08-15 Release 5.9 accounting
mRpL12 2008-12-18 5.12 accounting

Clone Sequence Records

GM03767.complete Sequence

693 bp (693 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060871

> GM03767.complete
CCCAAAGAATTTATTTTGTCACCCGAAAACCATACCAATAAGATGCACAT
CACACGCCTCGCCCTTCGCCAGATTTCGCGCCAAGTGCAGCTGCATCGCA
TGTACAGTGCAGCGGCTCCGGCCGCCGCAGTCTCGGGTGCGGAAAAACTG
GTGCCTCCCGCGCCGGAAGGAGCCGCCAAGCCACCCAATCCCAAACTGGA
CTCGATTGTCAACAACATTGCCGCGCTCAATCTCCTCGAGGTGGCCGAGC
TGAGCACCCTGCTCAAACAGAAACTGAACCTGCCCGAGACCGCATTTGCC
CCACAATTCGCCGCTGGGCCGGCACGTGCTGCTCCCGCCGAGGATGAGGA
GGAGGCAGCGCCCAAGAAGGTACAGACCTCCTTCAAGGTCAAGCTGGTCA
AGTTCGACGAAAAGCAGAAGGTGGCGCTGATCAAGGAGGTGAAGAACCTA
CTCGAGGGCATGAACCTGGTGCAGGCCAAAAAGTTCGTCGAGAGCGCACC
GACCATCGTTAAGGAGGACATCCCCAAGGAGGAGGCCGAGAAACTCAAGG
AGGCACTGTCCAAGGCGGGCGCCATCATCGAGATCGAGTAGGATCGGCCA
CGGTGCCTTCGTTTATCCACTTTGCGTTTAGCTGCTAGTTACTGTTTTAA
TAAAAAGCCAGGCAACATTTGCTGTAAAAAAAAAAAAAAAAAA

GM03767.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL12-RA 1008 mRpL12-RA 121..798 1..678 3390 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8948978..8949621 32..675 3220 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:16:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8956936..8957582 32..678 3235 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8950036..8950682 32..678 3235 100 Plus
3L 28103327 3L 8949949..8949979 1..31 155 100 Plus
Blast to na_te.dros performed 2019-03-15 15:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
G5 4856 G5 G5_DM 4856bp 567..652 491..409 117 61.6 Minus

GM03767.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:22:58 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8948891..8948921 1..31 100 -> Plus
chr3L 8948978..8949621 32..675 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:02:58 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:56 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:25:40 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:41 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:41 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 1..549 43..591 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:04 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 58..732 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:56 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 58..732 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:25:40 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 59..733 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:41 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 58..732 1..675 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:41 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL12-RA 59..733 1..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:22:58 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8956849..8956879 1..31 100 -> Plus
3L 8956936..8957579 32..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:22:58 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8956849..8956879 1..31 100 -> Plus
3L 8956936..8957579 32..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:22:58 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8956849..8956879 1..31 100 -> Plus
3L 8956936..8957579 32..675 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:25:40 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8949949..8949979 1..31 100 -> Plus
arm_3L 8950036..8950679 32..675 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:38 Download gff for GM03767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8950036..8950679 32..675 100   Plus
3L 8949949..8949979 1..31 100 -> Plus

GM03767.hyp Sequence

Translation from 0 to 590

> GM03767.hyp
PKEFILSPENHTNKMHITRLALRQISRQVQLHRMYSAAAPAAAVSGAEKL
VPPAPEGAAKPPNPKLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFA
PQFAAGPARAAPAEDEEEAAPKKVQTSFKVKLVKFDEKQKVALIKEVKNL
LEGMNLVQAKKFVESAPTIVKEDIPKEEAEKLKEALSKAGAIIEIE*

GM03767.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL12-PA 182 CG5012-PA 1..182 15..196 885 100 Plus

GM03767.pep Sequence

Translation from 42 to 590

> GM03767.pep
MHITRLALRQISRQVQLHRMYSAAAPAAAVSGAEKLVPPAPEGAAKPPNP
KLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFAPQFAAGPARAAPAE
DEEEAAPKKVQTSFKVKLVKFDEKQKVALIKEVKNLLEGMNLVQAKKFVE
SAPTIVKEDIPKEEAEKLKEALSKAGAIIEIE*

GM03767.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24365-PA 181 GF24365-PA 1..181 1..182 746 92.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14359-PA 182 GG14359-PA 1..182 1..182 891 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15337-PA 182 GH15337-PA 1..182 1..182 613 83.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL12-PA 182 CG5012-PA 1..182 1..182 885 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12941-PA 182 GI12941-PA 1..182 1..182 686 85.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20728-PA 181 GL20728-PA 1..181 1..182 686 89.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18594-PA 181 GA18594-PA 1..181 1..182 682 89 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25104-PA 182 GM25104-PA 1..182 1..182 896 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14139-PA 182 GD14139-PA 1..182 1..182 901 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13083-PA 182 GJ13083-PA 1..182 1..182 652 83.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16748-PA 183 GK16748-PA 1..183 1..182 748 85.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20790-PA 182 GE20790-PA 1..182 1..182 883 97.3 Plus