Clone GM03782 Report

Search the DGRC for GM03782

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:37
Well:82
Vector:pBS SK-
Associated Gene/TranscriptGmer-RA
Protein status:GM03782.pep: gold
Preliminary Size:1246
Sequenced Size:1069

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3495 2001-01-01 Release 2 assignment
CG3495 2001-10-10 Blastp of sequenced clone
CG3495 2003-01-01 Sim4 clustering to Release 3
Gmer 2008-04-29 Release 5.5 accounting
Gmer 2008-08-15 Release 5.9 accounting
Gmer 2008-12-18 5.12 accounting

Clone Sequence Records

GM03782.complete Sequence

1069 bp (1069 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060873

> GM03782.complete
AATTGACTTGATTTGTGGAATCGCACAAAGATCATGAAAAAAGTACTGGT
AACAGGCGGAACTGGGCTGGTGGGCAAGGCCCTGGAGGCTGTGATCAAGG
AGCAGTCCCCAGAGGACGAGCAATGGTTTTTTGCTGGCTCTAAAGATGCA
GATTTGACAAATCTGGCCGCCACGCAGGCACTCTTCGCCCGAGAGAAGCC
CACGCATGTCATCCATCTGGCTGCAATGGTCGGAGGCCTGTTCCACAACA
TGAACAACAACCTGGACTTCTTGCGCAACAACCTGCTCATTAACGACAAT
GTCCTGCAAACGGCACACGAACAGGGCTGCGTAAAGGTGGTGTCCTGCCT
GTCCACCTGCATTTTTCCGGACAAAACCAGCTACCCCATAGATGAGACCA
TGGTGCACAACGGGCCGCCGCACCCCTCCAATTATGGTTACTCCTACGCA
AAGCGACTGATAGACGTGCAGAACCACGCCTACCACGATAAATATGGCCG
GGTGTACACCTCAGTCATTCCGTGCAACATATTCGGTCCCCACGACAACT
ATAATCCAGAGGTCAGCCACGTCATTCCGGGCATGATCTATAGGATGCAC
CAGCTGGTTACGGAGAAGACTGACGTCCCCGAAAACGACAAGGTGTTCAC
CGTTTTCGGAAGCGGCATGCCACTACGGCAGTTTGTATACTCCCGGGACC
TGGCGGAGCTGATGATCTGGGTGCTCAGGAACTACGAAAGTGTGGAGCCC
ATCATCCTAAGCGCGGACGAAGTGCAAGAGGTGACCATCTTCGAGGTGGC
ACAGGCCGTTGCAAAAGCATTTAATTTTAATGGAAGACTGGTCTGTGATA
CGAGCAAGTCGGATGGACAGTACAAAAAGACTGCGTCTAATGCCAAGCTT
CGCTCCTTCCTGCCAGACTACGCATTTACGGACTTGGAAACGGCAATCAA
CGCCTCGGTTAAGTGGTACATAGAAAACTACGACCAGGCTAGAAAGTAAT
TGAATATTCCAACCCCAAAAAAATGTAAATAGATAACGAATTTTTCACAG
AAAAAAAAAAAAAAAAAAA

GM03782.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Gmer-RA 1124 Gmer-RA 72..1117 1..1044 4920 98.1 Plus
Gmer.a 1107 Gmer.a 60..1100 1..1044 4820 97.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18774367..18774933 832..266 2655 97.9 Minus
chr2R 21145070 chr2R 18774097..18774311 1044..832 995 98.6 Minus
chr2R 21145070 chr2R 18775153..18775310 158..1 730 97.5 Minus
chr2R 21145070 chr2R 18774984..18775098 273..159 575 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:16:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22887849..22888415 832..266 2640 97.7 Minus
2R 25286936 2R 22887579..22887793 1044..832 995 98.6 Minus
2R 25286936 2R 22888635..22888792 158..1 715 96.8 Minus
2R 25286936 2R 22888466..22888580 273..159 575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22889048..22889614 832..266 2640 97.7 Minus
2R 25260384 2R 22888778..22888992 1044..832 1005 98.6 Minus
2R 25260384 2R 22889834..22889991 158..1 715 96.8 Minus
2R 25260384 2R 22889665..22889779 273..159 575 100 Minus
Blast to na_te.dros performed 2019-03-16 13:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 1653..1708 989..1046 114 69 Plus

GM03782.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:29:59 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18774092..18774311 832..1050 98 <- Minus
chr2R 18774368..18774925 274..831 98 <- Minus
chr2R 18774984..18775098 159..273 100 <- Minus
chr2R 18775153..18775310 1..158 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:03:00 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 1..966 34..999 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:57 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 1..966 34..999 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:39:45 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 1..966 34..999 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:42 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 1..966 34..999 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:13:57 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 1..966 34..999 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:05 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 60..1110 1..1050 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:57 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 60..1110 1..1050 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:39:45 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 66..1116 1..1050 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:43 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 60..1110 1..1050 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:13:57 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
Gmer-RA 66..1116 1..1050 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:59 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22887574..22887793 832..1050 98 <- Minus
2R 22887850..22888407 274..831 98 <- Minus
2R 22888466..22888580 159..273 100 <- Minus
2R 22888635..22888792 1..158 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:59 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22887574..22887793 832..1050 98 <- Minus
2R 22887850..22888407 274..831 98 <- Minus
2R 22888466..22888580 159..273 100 <- Minus
2R 22888635..22888792 1..158 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:59 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22887574..22887793 832..1050 98 <- Minus
2R 22887850..22888407 274..831 98 <- Minus
2R 22888466..22888580 159..273 100 <- Minus
2R 22888635..22888792 1..158 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:39:45 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18775097..18775316 832..1050 98 <- Minus
arm_2R 18775373..18775930 274..831 98 <- Minus
arm_2R 18775989..18776103 159..273 100 <- Minus
arm_2R 18776158..18776315 1..158 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:39 Download gff for GM03782.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22888791..22889010 832..1050 98 <- Minus
2R 22889067..22889624 274..831 98 <- Minus
2R 22889683..22889797 159..273 100 <- Minus
2R 22889852..22890009 1..158 96   Minus

GM03782.pep Sequence

Translation from 33 to 998

> GM03782.pep
MKKVLVTGGTGLVGKALEAVIKEQSPEDEQWFFAGSKDADLTNLAATQAL
FAREKPTHVIHLAAMVGGLFHNMNNNLDFLRNNLLINDNVLQTAHEQGCV
KVVSCLSTCIFPDKTSYPIDETMVHNGPPHPSNYGYSYAKRLIDVQNHAY
HDKYGRVYTSVIPCNIFGPHDNYNPEVSHVIPGMIYRMHQLVTEKTDVPE
NDKVFTVFGSGMPLRQFVYSRDLAELMIWVLRNYESVEPIILSADEVQEV
TIFEVAQAVAKAFNFNGRLVCDTSKSDGQYKKTASNAKLRSFLPDYAFTD
LETAINASVKWYIENYDQARK*

GM03782.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11320-PA 321 GF11320-PA 1..321 1..321 1550 86.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20086-PA 321 GG20086-PA 1..321 1..321 1637 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20607-PA 321 GH20607-PA 1..320 1..320 1464 82.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Gmer-PA 321 CG3495-PA 1..321 1..321 1696 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19163-PA 321 GI19163-PA 1..320 1..320 1477 82.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10196-PA 307 GL10196-PA 1..307 1..321 1401 79.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17480-PA 321 GA17480-PA 1..321 1..321 1534 84.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15602-PA 321 GM15602-PA 1..321 1..321 1659 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25098-PA 321 GD25098-PA 1..321 1..321 1670 95.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20119-PA 321 GJ20119-PA 1..320 1..320 1473 82.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20854-PA 322 GK20854-PA 1..322 1..321 1455 80.7 Plus
Dwil\GK19108-PA 277 GK19108-PA 1..273 85..312 234 25.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11625-PA 321 GE11625-PA 1..321 1..321 1630 93.1 Plus

GM03782.hyp Sequence

Translation from 33 to 998

> GM03782.hyp
MKKVLVTGGTGLVGKALEAVIKEQSPEDEQWFFAGSKDADLTNLAATQAL
FAREKPTHVIHLAAMVGGLFHNMNNNLDFLRNNLLINDNVLQTAHEQGCV
KVVSCLSTCIFPDKTSYPIDETMVHNGPPHPSNYGYSYAKRLIDVQNHAY
HDKYGRVYTSVIPCNIFGPHDNYNPEVSHVIPGMIYRMHQLVTEKTDVPE
NDKVFTVFGSGMPLRQFVYSRDLAELMIWVLRNYESVEPIILSADEVQEV
TIFEVAQAVAKAFNFNGRLVCDTSKSDGQYKKTASNAKLRSFLPDYAFTD
LETAINASVKWYIENYDQARK*

GM03782.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
Gmer-PA 321 CG3495-PA 1..321 1..321 1696 100 Plus