Clone GM04029 Report

Search the DGRC for GM04029

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:40
Well:29
Vector:pBS SK-
Associated Gene/TranscriptmRpL10-RA
Protein status:GM04029.pep: gold
Preliminary Size:1084
Sequenced Size:888

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11488 2001-01-01 Release 2 assignment
CG11488 2001-10-10 Blastp of sequenced clone
CG11488 2003-01-01 Sim4 clustering to Release 3
mRpL10 2008-04-29 Release 5.5 accounting
mRpL10 2008-08-15 Release 5.9 accounting
mRpL10 2008-12-18 5.12 accounting

Clone Sequence Records

GM04029.complete Sequence

888 bp (888 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060877

> GM04029.complete
AATAAGGAGAAGTTCTAGTTTTAGAGATTAGATACCTTAATACAGTTCTA
CAGCATGGCCACCCTGATACAAAGAAGCCTTTCCCTGGCTAAGAGCAGTA
CTCCTGCGCTACAATTTCTTCGCTTTAGGGGTAAGATCAATATACAGCGG
CCGAAAGCACCGCACTACGAGCGGGCCCGGGTAGTCGCAGTCACGCAGCC
GAAATATCCGGAACTCCCAAAAGCTAAGAGCTGCTTCAAAACGCGTGCGG
AGCGCACGCAACAGCAGCAGGAGAATCCATACAACGAAATCATCGCACGA
GAGGTGCGGAATTGGCTGGATCATTCCCGACTGGTTGCCTTCTTTCACTT
AAGTTCTATAACCGCCGATGACATCTTCCGCGTGCGCGTTCAGCTTCACA
AGCAGAACCTGCACCTCAAGTCCTACGGCAGCAAGATCATCGAACAGGCG
GTGAAGAATACTCGATACGAAGCGATTGTGCCCCTGTTCCACTCCAATCA
TTGCATCGTCTTCTCACCGGACCCGGAAAAGACTGCCGCACTGCTACGAA
TCGTTCGCAGGGTGCCGCAAATGGTCCTGCTGGGAGGCATCGTGGAGGAG
ACCATGCTGAGTAGGAACCAGCTTGTGGCCTACGCTCAGATGCCCGGCCT
GCACGCGGTCCAGGCACAACTTGTCCAGACCCTTAGTCAAGCACCTGGCC
ACCTTATTCAGCAACTGCAGGCCCATCAGAACAGTTTTGTGCAAGTTCTT
GATGTCCATGCTAAAAACCAGATGAATGAGGAAACGCCAAAGTCTACGTA
GAAGTCAAAAAAGTCAAGTTTGTTATATAACAAGAAATCAAAAATTATAT
AATTGTTTTTCACTCTAAAAAAAAAAAAAAAAAAAAAA

GM04029.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL10-RA 993 mRpL10-RA 99..967 1..869 4345 100 Plus
CG11617-RA 1267 CG11617-RA 1217..1267 869..819 255 100 Minus
CG11617.a 1420 CG11617.a 1370..1420 869..819 255 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 204045..204834 77..866 3950 100 Plus
chr2L 23010047 chr2L 203868..203944 1..77 385 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:16:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 203993..204785 77..869 3965 100 Plus
2L 23513712 2L 203816..203892 1..77 385 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 203993..204785 77..869 3965 100 Plus
2L 23513712 2L 203816..203892 1..77 385 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:55:37 has no hits.

GM04029.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:56:43 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 203868..203943 1..76 100 -> Plus
chr2L 204045..204834 77..866 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:03:08 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 1..747 55..801 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:24:42 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 1..747 55..801 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:34:44 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 1..747 55..801 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:51:44 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 1..747 55..801 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:46:01 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 1..747 55..801 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:00:19 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 33..898 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:24:42 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 33..898 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:34:44 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 38..903 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:51:44 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 33..898 1..866 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:46:01 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL10-RA 38..903 1..866 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:43 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
2L 203816..203891 1..76 100 -> Plus
2L 203993..204782 77..866 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:43 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
2L 203816..203891 1..76 100 -> Plus
2L 203993..204782 77..866 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:43 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
2L 203816..203891 1..76 100 -> Plus
2L 203993..204782 77..866 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:34:44 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 203816..203891 1..76 100 -> Plus
arm_2L 203993..204782 77..866 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:27:55 Download gff for GM04029.complete
Subject Subject Range Query Range Percent Splice Strand
2L 203993..204782 77..866 100   Plus
2L 203816..203891 1..76 100 -> Plus

GM04029.hyp Sequence

Translation from 54 to 800

> GM04029.hyp
MATLIQRSLSLAKSSTPALQFLRFRGKINIQRPKAPHYERARVVAVTQPK
YPELPKAKSCFKTRAERTQQQQENPYNEIIAREVRNWLDHSRLVAFFHLS
SITADDIFRVRVQLHKQNLHLKSYGSKIIEQAVKNTRYEAIVPLFHSNHC
IVFSPDPEKTAALLRIVRRVPQMVLLGGIVEETMLSRNQLVAYAQMPGLH
AVQAQLVQTLSQAPGHLIQQLQAHQNSFVQVLDVHAKNQMNEETPKST*

GM04029.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL10-PA 248 CG11488-PA 1..248 1..248 1261 100 Plus

GM04029.pep Sequence

Translation from 54 to 800

> GM04029.pep
MATLIQRSLSLAKSSTPALQFLRFRGKINIQRPKAPHYERARVVAVTQPK
YPELPKAKSCFKTRAERTQQQQENPYNEIIAREVRNWLDHSRLVAFFHLS
SITADDIFRVRVQLHKQNLHLKSYGSKIIEQAVKNTRYEAIVPLFHSNHC
IVFSPDPEKTAALLRIVRRVPQMVLLGGIVEETMLSRNQLVAYAQMPGLH
AVQAQLVQTLSQAPGHLIQQLQAHQNSFVQVLDVHAKNQMNEETPKST*

GM04029.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20722-PA 253 GF20722-PA 1..247 1..247 1059 77.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24703-PA 248 GG24703-PA 1..248 1..248 1237 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11540-PA 253 GH11540-PA 1..238 1..238 959 73.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL10-PA 248 CG11488-PA 1..248 1..248 1261 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17030-PA 256 GI17030-PA 1..243 1..243 952 71.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11028-PA 253 GA11028-PA 1..244 1..244 1008 76.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16723-PA 248 GM16723-PA 1..248 1..248 1275 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23008-PA 248 GD23008-PA 1..248 1..248 1269 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24613-PA 250 GJ24613-PA 1..248 1..248 952 71 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23913-PA 258 GK23913-PA 1..248 1..248 942 70.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16648-PA 248 GE16648-PA 1..248 1..248 1216 91.9 Plus