BDGP Sequence Production Resources |
Search the DGRC for GM04427
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 44 |
Well: | 27 |
Vector: | pBS SK- |
Associated Gene/Transcript | CG5532-RA |
Protein status: | GM04427.pep: gold |
Preliminary Size: | 800 |
Sequenced Size: | 601 |
Gene | Date | Evidence |
---|---|---|
CG5532 | 2001-01-01 | Release 2 assignment |
CG5532 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5532 | 2008-04-29 | Release 5.5 accounting |
CG5532 | 2008-08-15 | Release 5.9 accounting |
CG5532 | 2008-12-18 | 5.12 accounting |
601 bp (601 high quality bases) assembled on 2001-10-10
GenBank Submission: AY060885.1
> GM04427.complete CCACTTCTCACCAAAACAAAGGTTACCCCGAAATTTAATCAAAATAAATC GAAATGCCGGTGGATTGGTTCGGATATGTGTACGCAGCCACGGTCGCCGC CGGAGGAATCATGGGATACGCCAAGGCGGGTTCCATTCCCTCGCTGGGTG CTGGTCTGGCCTTCGGAGCCCTGCTCGGTTATGGCGCCCACCTCAACTCC CAGGACACGCCTCGTCCCCTGCTCCAGCTGGGCACCTCCCTGTTCCTGGC CGGGCTGATGGGCGCCCGCTGGAACCGATCCGGAAAACTGATGCCCGCCG GAATGGTGTGCATGCTATCCGTGGCCGCCTTGGTCAAGAACCTGGCCACC TATAATCGCTACCTAATGCCTGCCGGCACAAAGGCCCCTTAGGCTAATTT CCGGCCACATGCTGGACTTGCCAGGAGATTGCCCTACCTTCATTCTTCAT TCGTATTGAATAGGTTTTCTACTTTTCGGTGATTGGAACTTTGCTAATGC GCTGTGTCACTTTCTAAGATAGTGATTAGGAACTGTACTTGCTGCAAATA TATTTTATCACCTATGCTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA A
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5532-RA | 791 | CG5532-RA | 112..684 | 1..573 | 2805 | 99.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19638922..19639050 | 1..129 | 100 | -> | Plus |
chr2R | 19639110..19639551 | 130..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 1..339 | 54..392 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 1..339 | 54..392 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 1..339 | 54..392 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 1..339 | 54..392 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 1..339 | 54..392 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 14..584 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 37..607 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 24..594 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 14..584 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5532-RA | 24..594 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23752777..23752905 | 1..129 | 100 | -> | Plus |
2R | 23752965..23753406 | 130..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23752777..23752905 | 1..129 | 100 | -> | Plus |
2R | 23752965..23753406 | 130..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23752777..23752905 | 1..129 | 100 | -> | Plus |
2R | 23752965..23753406 | 130..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19640300..19640428 | 1..129 | 100 | -> | Plus |
arm_2R | 19640488..19640929 | 130..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23754182..23754623 | 130..571 | 99 | Plus | |
2R | 23753994..23754122 | 1..129 | 100 | -> | Plus |
Translation from 0 to 354
> GM04427.hyp HFSPKQRLPRNLIKINRNAGGLVRICVRSHGRRRRNHGIRQGGFHSLAGC WSGLRSPARLWRPPQLPGHASSPAPVGHLPVPGRADGRPLEPIRKTDARR NGVHAIRGRLGQEPGHL*
Translation from 53 to 391
> GM04427.pep MPVDWFGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQ DTPRPLLQLGTSLFLAGLMGARWNRSGKLMPAGMVCMLSVAALVKNLATY NRYLMPAGTKAP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12504-PA | 113 | GF12504-PA | 1..111 | 1..110 | 497 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22885-PA | 112 | GG22885-PA | 1..112 | 1..112 | 554 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20749-PA | 111 | GH20749-PA | 1..109 | 1..110 | 488 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5532-PB | 112 | CG5532-PB | 1..112 | 1..112 | 582 | 100 | Plus |
CG5532-PA | 112 | CG5532-PA | 1..112 | 1..112 | 582 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20833-PA | 111 | GI20833-PA | 1..109 | 1..110 | 495 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11032-PA | 113 | GL11032-PA | 1..111 | 1..110 | 491 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24583-PA | 113 | GA24583-PA | 1..111 | 1..110 | 491 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16045-PA | 112 | GM16045-PA | 1..112 | 1..112 | 560 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11795-PA | 112 | GD11795-PA | 1..112 | 1..112 | 552 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20566-PA | 111 | GJ20566-PA | 1..109 | 1..110 | 494 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22195-PA | 113 | GK22195-PA | 1..111 | 1..110 | 501 | 90.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14323-PA | 112 | GE14323-PA | 1..112 | 1..112 | 538 | 93.8 | Plus |