Clone GM04427 Report

Search the DGRC for GM04427

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:44
Well:27
Vector:pBS SK-
Associated Gene/TranscriptCG5532-RA
Protein status:GM04427.pep: gold
Preliminary Size:800
Sequenced Size:601

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5532 2001-01-01 Release 2 assignment
CG5532 2003-01-01 Sim4 clustering to Release 3
CG5532 2008-04-29 Release 5.5 accounting
CG5532 2008-08-15 Release 5.9 accounting
CG5532 2008-12-18 5.12 accounting

Clone Sequence Records

GM04427.complete Sequence

601 bp (601 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060885.1

> GM04427.complete
CCACTTCTCACCAAAACAAAGGTTACCCCGAAATTTAATCAAAATAAATC
GAAATGCCGGTGGATTGGTTCGGATATGTGTACGCAGCCACGGTCGCCGC
CGGAGGAATCATGGGATACGCCAAGGCGGGTTCCATTCCCTCGCTGGGTG
CTGGTCTGGCCTTCGGAGCCCTGCTCGGTTATGGCGCCCACCTCAACTCC
CAGGACACGCCTCGTCCCCTGCTCCAGCTGGGCACCTCCCTGTTCCTGGC
CGGGCTGATGGGCGCCCGCTGGAACCGATCCGGAAAACTGATGCCCGCCG
GAATGGTGTGCATGCTATCCGTGGCCGCCTTGGTCAAGAACCTGGCCACC
TATAATCGCTACCTAATGCCTGCCGGCACAAAGGCCCCTTAGGCTAATTT
CCGGCCACATGCTGGACTTGCCAGGAGATTGCCCTACCTTCATTCTTCAT
TCGTATTGAATAGGTTTTCTACTTTTCGGTGATTGGAACTTTGCTAATGC
GCTGTGTCACTTTCTAAGATAGTGATTAGGAACTGTACTTGCTGCAAATA
TATTTTATCACCTATGCTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

GM04427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5532-RA 791 CG5532-RA 112..684 1..573 2805 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19639109..19639551 129..571 2170 99.3 Plus
chr2R 21145070 chr2R 19638922..19639052 1..131 655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:16:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23752964..23753408 129..573 2165 99.1 Plus
2R 25286936 2R 23752777..23752907 1..131 655 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23754163..23754607 129..573 2165 99.1 Plus
2R 25260384 2R 23753976..23754106 1..131 655 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:18:07 has no hits.

GM04427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:19:01 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19638922..19639050 1..129 100 -> Plus
chr2R 19639110..19639551 130..571 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:03:28 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 1..339 54..392 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:04 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 1..339 54..392 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:31:43 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 1..339 54..392 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:18:42 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 1..339 54..392 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:17 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 1..339 54..392 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:46:08 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 14..584 1..571 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:04 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 37..607 1..571 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:31:43 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 24..594 1..571 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:18:42 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 14..584 1..571 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:17 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 24..594 1..571 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:19:01 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23752777..23752905 1..129 100 -> Plus
2R 23752965..23753406 130..571 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:19:01 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23752777..23752905 1..129 100 -> Plus
2R 23752965..23753406 130..571 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:19:01 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23752777..23752905 1..129 100 -> Plus
2R 23752965..23753406 130..571 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:31:43 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19640300..19640428 1..129 100 -> Plus
arm_2R 19640488..19640929 130..571 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:13:42 Download gff for GM04427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23754182..23754623 130..571 99   Plus
2R 23753994..23754122 1..129 100 -> Plus

GM04427.hyp Sequence

Translation from 0 to 354

> GM04427.hyp
HFSPKQRLPRNLIKINRNAGGLVRICVRSHGRRRRNHGIRQGGFHSLAGC
WSGLRSPARLWRPPQLPGHASSPAPVGHLPVPGRADGRPLEPIRKTDARR
NGVHAIRGRLGQEPGHL*
Sequence GM04427.hyp has no blast hits.

GM04427.pep Sequence

Translation from 53 to 391

> GM04427.pep
MPVDWFGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQ
DTPRPLLQLGTSLFLAGLMGARWNRSGKLMPAGMVCMLSVAALVKNLATY
NRYLMPAGTKAP*

GM04427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12504-PA 113 GF12504-PA 1..111 1..110 497 88.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22885-PA 112 GG22885-PA 1..112 1..112 554 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20749-PA 111 GH20749-PA 1..109 1..110 488 90.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG5532-PB 112 CG5532-PB 1..112 1..112 582 100 Plus
CG5532-PA 112 CG5532-PA 1..112 1..112 582 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20833-PA 111 GI20833-PA 1..109 1..110 495 90.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11032-PA 113 GL11032-PA 1..111 1..110 491 86.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24583-PA 113 GA24583-PA 1..111 1..110 491 86.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16045-PA 112 GM16045-PA 1..112 1..112 560 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11795-PA 112 GD11795-PA 1..112 1..112 552 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20566-PA 111 GJ20566-PA 1..109 1..110 494 90.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22195-PA 113 GK22195-PA 1..111 1..110 501 90.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14323-PA 112 GE14323-PA 1..112 1..112 538 93.8 Plus