Clone GM04682 Report

Search the DGRC for GM04682

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:46
Well:82
Vector:pBS SK-
Associated Gene/Transcripttwr-RA
Protein status:GM04682.pep: gold
Preliminary Size:692
Sequenced Size:861

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2358 2001-01-01 Release 2 assignment
CG2358 2002-12-11 Blastp of sequenced clone
CG2358 2003-01-01 Sim4 clustering to Release 3
Spase18-21 2008-04-29 Release 5.5 accounting
Spase18-21 2008-08-15 Release 5.9 accounting
Spase18-21 2008-12-18 5.12 accounting

Clone Sequence Records

GM04682.complete Sequence

861 bp (861 high quality bases) assembled on 2002-12-11

GenBank Submission: AF160889

> GM04682.complete
GCAACTCGGCCTAAACATACGTGTCGGAAATTTTCTGTCTTCGTGGACGA
AGCCGAGAAGTTTTGTTAAGGACCTTTTCAATTGCATTTAAAAAGGCTAT
TTCCTCCACAAGCACCGCAATAACAGCCGCAGCCATGGGCGTAGCCAGCA
TGTTGCAGATTGACGAGATGCTGGGCGACTTCAACAGAATGAACAAGCGT
CAGTCGCTGTACCAGGTGCTGAGCTTCGCCATGATCGTCTCCTCGGCGCT
GATGATCTGGAAGGGCCTGATGGTGGTCACCGGCAGCGAGTCGCCGATCG
TTGTCGTGCTCAGTGGCAGCATGGAGCCGGCTTTCCACCGCGGCGACCTC
CTCTTCCTCACTAACTACAAGGAGGAGCCGGTGCGCGTCGGCGAGATCGT
CGTCTTCAAGGTGGAGGGCAGGGACATACCCATTGTACACCGCGTCATCA
AGCTGCACGAAAAAGAGGACGGATCCGTCAAGTTCCTGACCAAGGGCGAC
AATAACAACGTGGACGACCGGGGCCTGTATGCACCCAACCAGCTGTGGCT
GACCAAAAAGGACATTGTGGGCCGGGCCAGGGGCTTCCTGCCTTACGTGG
GCATCATCACGATCTTCATGAACGAATATCCCAAGGTTAAGTGGGCCATT
CTCTCTATTTTGGCCATTTTCGTGCTGCTGCATCGGGAGTAGATGGGATC
GCTCTTATTTTGTAGGTACAGTTTATAAGTAGGAAGTGCACAATCTCGAG
CCTGTCTGCATTTTCAAATTCCTTACCACCCCAACAGTAAGACCATTGTG
CGGAGTTGAGTTTCAATAAAGATACGAGTAACGATTTTTAAAAAAAAAAA
AAAAAAAAAAA

GM04682.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Spase18-21-RA 1039 Spase18-21-RA 112..952 1..841 4205 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2483967..2484229 201..463 1315 100 Plus
chr3R 27901430 chr3R 2483697..2483899 1..203 1015 100 Plus
chr3R 27901430 chr3R 2485042..2485241 640..839 1000 100 Plus
chr3R 27901430 chr3R 2484805..2484982 464..641 890 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:16:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6658165..6658427 201..463 1315 100 Plus
3R 32079331 3R 6657895..6658097 1..203 1015 100 Plus
3R 32079331 3R 6659240..6659441 640..841 1010 100 Plus
3R 32079331 3R 6659003..6659180 464..641 890 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6398996..6399258 201..463 1315 100 Plus
3R 31820162 3R 6398726..6398928 1..203 1015 100 Plus
3R 31820162 3R 6400071..6400272 640..841 1010 100 Plus
3R 31820162 3R 6399834..6400011 464..641 890 100 Plus
Blast to na_te.dros performed 2019-03-16 15:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 5786..5861 533..608 110 65.8 Plus

GM04682.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:32:23 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2484805..2484982 464..641 100 -> Plus
chr3R 2485044..2485241 642..839 100   Plus
chr3R 2483697..2483899 1..203 100 -> Plus
chr3R 2483970..2484229 204..463 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:03:36 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
Spase18-21-RA 1..558 135..692 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:55 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
Spase18-21-RA 1..558 135..692 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:47:21 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
twr-RA 1..558 135..692 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:51 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
Spase18-21-RA 1..558 135..692 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:48:05 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
twr-RA 1..558 135..692 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:31 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
Spase18-21-RA 14..852 1..839 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:55 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
Spase18-21-RA 14..852 1..839 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:47:21 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
twr-RA 14..852 1..839 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:51 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
Spase18-21-RA 14..852 1..839 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:48:05 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
twr-RA 14..852 1..839 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:23 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6657895..6658097 1..203 100 -> Plus
3R 6658168..6658427 204..463 100 -> Plus
3R 6659003..6659180 464..641 100 -> Plus
3R 6659242..6659439 642..839 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:23 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6657895..6658097 1..203 100 -> Plus
3R 6658168..6658427 204..463 100 -> Plus
3R 6659003..6659180 464..641 100 -> Plus
3R 6659242..6659439 642..839 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:23 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6657895..6658097 1..203 100 -> Plus
3R 6658168..6658427 204..463 100 -> Plus
3R 6659003..6659180 464..641 100 -> Plus
3R 6659242..6659439 642..839 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:47:21 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2483617..2483819 1..203 100 -> Plus
arm_3R 2483890..2484149 204..463 100 -> Plus
arm_3R 2484725..2484902 464..641 100 -> Plus
arm_3R 2484964..2485161 642..839 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:43 Download gff for GM04682.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6398726..6398928 1..203 100 -> Plus
3R 6398999..6399258 204..463 100 -> Plus
3R 6399834..6400011 464..641 100 -> Plus
3R 6400073..6400270 642..839 100   Plus

GM04682.hyp Sequence

Translation from 134 to 691

> GM04682.hyp
MGVASMLQIDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTG
SESPIVVVLSGSMEPAFHRGDLLFLTNYKEEPVRVGEIVVFKVEGRDIPI
VHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPNQLWLTKKDIVGRARG
FLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE*

GM04682.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
twr-PA 185 CG2358-PA 1..185 1..185 944 100 Plus

GM04682.pep Sequence

Translation from 134 to 691

> GM04682.pep
MGVASMLQIDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTG
SESPIVVVLSGSMEPAFHRGDLLFLTNYKEEPVRVGEIVVFKVEGRDIPI
VHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPNQLWLTKKDIVGRARG
FLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE*

GM04682.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17183-PA 185 GF17183-PA 1..185 1..185 962 98.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13600-PA 185 GG13600-PA 1..185 1..185 966 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18124-PA 185 GH18124-PA 1..185 1..185 949 97.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
twr-PA 185 CG2358-PA 1..185 1..185 944 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23840-PA 185 GI23840-PA 1..185 1..185 949 97.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21767-PA 185 GL21767-PA 1..185 1..185 962 99.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15357-PA 185 GA15357-PA 1..185 1..185 962 99.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10908-PA 185 GM10908-PA 1..185 1..185 966 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19887-PA 185 GD19887-PA 1..185 1..185 966 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23297-PA 185 GJ23297-PA 1..185 1..185 952 97.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12245-PA 185 GK12245-PA 1..185 1..185 949 97.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24877-PA 185 GE24877-PA 1..185 1..185 966 100 Plus