BDGP Sequence Production Resources |
Search the DGRC for GM04682
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 46 |
Well: | 82 |
Vector: | pBS SK- |
Associated Gene/Transcript | twr-RA |
Protein status: | GM04682.pep: gold |
Preliminary Size: | 692 |
Sequenced Size: | 861 |
Gene | Date | Evidence |
---|---|---|
CG2358 | 2001-01-01 | Release 2 assignment |
CG2358 | 2002-12-11 | Blastp of sequenced clone |
CG2358 | 2003-01-01 | Sim4 clustering to Release 3 |
Spase18-21 | 2008-04-29 | Release 5.5 accounting |
Spase18-21 | 2008-08-15 | Release 5.9 accounting |
Spase18-21 | 2008-12-18 | 5.12 accounting |
861 bp (861 high quality bases) assembled on 2002-12-11
GenBank Submission: AF160889
> GM04682.complete GCAACTCGGCCTAAACATACGTGTCGGAAATTTTCTGTCTTCGTGGACGA AGCCGAGAAGTTTTGTTAAGGACCTTTTCAATTGCATTTAAAAAGGCTAT TTCCTCCACAAGCACCGCAATAACAGCCGCAGCCATGGGCGTAGCCAGCA TGTTGCAGATTGACGAGATGCTGGGCGACTTCAACAGAATGAACAAGCGT CAGTCGCTGTACCAGGTGCTGAGCTTCGCCATGATCGTCTCCTCGGCGCT GATGATCTGGAAGGGCCTGATGGTGGTCACCGGCAGCGAGTCGCCGATCG TTGTCGTGCTCAGTGGCAGCATGGAGCCGGCTTTCCACCGCGGCGACCTC CTCTTCCTCACTAACTACAAGGAGGAGCCGGTGCGCGTCGGCGAGATCGT CGTCTTCAAGGTGGAGGGCAGGGACATACCCATTGTACACCGCGTCATCA AGCTGCACGAAAAAGAGGACGGATCCGTCAAGTTCCTGACCAAGGGCGAC AATAACAACGTGGACGACCGGGGCCTGTATGCACCCAACCAGCTGTGGCT GACCAAAAAGGACATTGTGGGCCGGGCCAGGGGCTTCCTGCCTTACGTGG GCATCATCACGATCTTCATGAACGAATATCCCAAGGTTAAGTGGGCCATT CTCTCTATTTTGGCCATTTTCGTGCTGCTGCATCGGGAGTAGATGGGATC GCTCTTATTTTGTAGGTACAGTTTATAAGTAGGAAGTGCACAATCTCGAG CCTGTCTGCATTTTCAAATTCCTTACCACCCCAACAGTAAGACCATTGTG CGGAGTTGAGTTTCAATAAAGATACGAGTAACGATTTTTAAAAAAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Spase18-21-RA | 1039 | Spase18-21-RA | 112..952 | 1..841 | 4205 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 2483967..2484229 | 201..463 | 1315 | 100 | Plus |
chr3R | 27901430 | chr3R | 2483697..2483899 | 1..203 | 1015 | 100 | Plus |
chr3R | 27901430 | chr3R | 2485042..2485241 | 640..839 | 1000 | 100 | Plus |
chr3R | 27901430 | chr3R | 2484805..2484982 | 464..641 | 890 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 6658165..6658427 | 201..463 | 1315 | 100 | Plus |
3R | 32079331 | 3R | 6657895..6658097 | 1..203 | 1015 | 100 | Plus |
3R | 32079331 | 3R | 6659240..6659441 | 640..841 | 1010 | 100 | Plus |
3R | 32079331 | 3R | 6659003..6659180 | 464..641 | 890 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 6398996..6399258 | 201..463 | 1315 | 100 | Plus |
3R | 31820162 | 3R | 6398726..6398928 | 1..203 | 1015 | 100 | Plus |
3R | 31820162 | 3R | 6400071..6400272 | 640..841 | 1010 | 100 | Plus |
3R | 31820162 | 3R | 6399834..6400011 | 464..641 | 890 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 5786..5861 | 533..608 | 110 | 65.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 2484805..2484982 | 464..641 | 100 | -> | Plus |
chr3R | 2485044..2485241 | 642..839 | 100 | Plus | |
chr3R | 2483697..2483899 | 1..203 | 100 | -> | Plus |
chr3R | 2483970..2484229 | 204..463 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase18-21-RA | 1..558 | 135..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase18-21-RA | 1..558 | 135..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
twr-RA | 1..558 | 135..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase18-21-RA | 1..558 | 135..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
twr-RA | 1..558 | 135..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase18-21-RA | 14..852 | 1..839 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase18-21-RA | 14..852 | 1..839 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
twr-RA | 14..852 | 1..839 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spase18-21-RA | 14..852 | 1..839 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
twr-RA | 14..852 | 1..839 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6657895..6658097 | 1..203 | 100 | -> | Plus |
3R | 6658168..6658427 | 204..463 | 100 | -> | Plus |
3R | 6659003..6659180 | 464..641 | 100 | -> | Plus |
3R | 6659242..6659439 | 642..839 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6657895..6658097 | 1..203 | 100 | -> | Plus |
3R | 6658168..6658427 | 204..463 | 100 | -> | Plus |
3R | 6659003..6659180 | 464..641 | 100 | -> | Plus |
3R | 6659242..6659439 | 642..839 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6657895..6658097 | 1..203 | 100 | -> | Plus |
3R | 6658168..6658427 | 204..463 | 100 | -> | Plus |
3R | 6659003..6659180 | 464..641 | 100 | -> | Plus |
3R | 6659242..6659439 | 642..839 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 2483617..2483819 | 1..203 | 100 | -> | Plus |
arm_3R | 2483890..2484149 | 204..463 | 100 | -> | Plus |
arm_3R | 2484725..2484902 | 464..641 | 100 | -> | Plus |
arm_3R | 2484964..2485161 | 642..839 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6398726..6398928 | 1..203 | 100 | -> | Plus |
3R | 6398999..6399258 | 204..463 | 100 | -> | Plus |
3R | 6399834..6400011 | 464..641 | 100 | -> | Plus |
3R | 6400073..6400270 | 642..839 | 100 | Plus |
Translation from 134 to 691
> GM04682.hyp MGVASMLQIDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTG SESPIVVVLSGSMEPAFHRGDLLFLTNYKEEPVRVGEIVVFKVEGRDIPI VHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPNQLWLTKKDIVGRARG FLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
twr-PA | 185 | CG2358-PA | 1..185 | 1..185 | 944 | 100 | Plus |
Translation from 134 to 691
> GM04682.pep MGVASMLQIDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTG SESPIVVVLSGSMEPAFHRGDLLFLTNYKEEPVRVGEIVVFKVEGRDIPI VHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPNQLWLTKKDIVGRARG FLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17183-PA | 185 | GF17183-PA | 1..185 | 1..185 | 962 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13600-PA | 185 | GG13600-PA | 1..185 | 1..185 | 966 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18124-PA | 185 | GH18124-PA | 1..185 | 1..185 | 949 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
twr-PA | 185 | CG2358-PA | 1..185 | 1..185 | 944 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23840-PA | 185 | GI23840-PA | 1..185 | 1..185 | 949 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21767-PA | 185 | GL21767-PA | 1..185 | 1..185 | 962 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15357-PA | 185 | GA15357-PA | 1..185 | 1..185 | 962 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10908-PA | 185 | GM10908-PA | 1..185 | 1..185 | 966 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19887-PA | 185 | GD19887-PA | 1..185 | 1..185 | 966 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23297-PA | 185 | GJ23297-PA | 1..185 | 1..185 | 952 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12245-PA | 185 | GK12245-PA | 1..185 | 1..185 | 949 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24877-PA | 185 | GE24877-PA | 1..185 | 1..185 | 966 | 100 | Plus |