Clone GM05702 Report

Search the DGRC for GM05702

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:57
Well:2
Vector:pBS SK-
Associated Gene/TranscriptCG7598-RA
Protein status:GM05702.pep: gold
Preliminary Size:1208
Sequenced Size:1028

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7598 2001-01-01 Release 2 assignment
CG7598 2001-10-10 Blastp of sequenced clone
CG7598 2008-04-29 Release 5.5 accounting
CG7598 2008-08-15 Release 5.9 accounting
CG7598 2008-12-18 5.12 accounting

Clone Sequence Records

GM05702.complete Sequence

1028 bp (1028 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060912

> GM05702.complete
TAGAGAAATAAGATTTACTTCAACCTAAACCAATGCCACGATGAATAGTC
TCCTGCGACAAGGACTCCGCCTGGGCTGCTGCCTTCCGGCTGTCCAGCAG
CAAATCCACACCACCGCCGTGCACAGGACATTCTGGGAGCGCGAGAAAAA
GTCCGGCTACAAGACCAAGCTGCCGGAACCCTCGAAGAAGCAGATGATCA
TGGACGGATTGAGGGACCTTAAAGAGGAGATGAAGCTGTGGCGCCAGGAG
GTCAAGGAGCAGTTCGAAAGTGATCCCATCCTGGTCTTCCGGCCGGGTGA
AACGGATGTGGTGTTCGATTTCAAGGCGCCGGATGTGCTGGACAAGTGGA
CGGTGACCACCGATGCGGATCACGGCGAGGGCAAGAGTACTGCCACTCTG
GAACTAAGTGCAGCCGGTGCTGGACTCTTCCATGGCCAAGTCAACTCGGA
TCACACCAAGGATGGCATTATCAAAAGGACGGGATATGCGAACATTCGCA
CGAAGAGAGTGCGGAAATCCTTTAAGCGCGAGACCACCTATGACTGGACG
CAGTACAACATGCTGGTCATGAAGGTGCGAGGCGATGGACGCAGCTACCT
GATCAACCTGCATACCGAAGGCTACTTCGACCTGATGTGGAACGACATCT
ACCACTATGTTCTGTACACGCGCGGAGGTCCCCACTGGCAGATAGCGAAG
ATTCCCTTCTCCAAGTTCTTCCTGTCTTCCAAGGGACGTGTCCAGGATCG
CCAGGGCGCCATACCGCTGAACAGGGTAACCCACTTCGGATTCTCCGTTG
CCGCAAAGAAGGGAATGGATGGCCCGTTTGGCCTGGAAATAGACTATGTG
GGTCTGGAGTACGATCCCAGTCACCGCGAGGAATTCGCCTACGAAATGTA
CCAGACTCCCAAATACATCGTGGCCACGTAACGTAACCGCCTAACGTTAC
GTTTGTGTTATTTAATTGTAGAAACGTACGAAGAGCAGTAAAGATTGGTT
AGCAGAAACAAAAAAAAAAAAAAAAAAA

GM05702.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7598-RA 1219 CG7598-RA 157..1166 1..1010 4945 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25559600..25560113 1..514 2510 99.2 Plus
chr3R 27901430 chr3R 25560171..25560666 514..1009 2465 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:17:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29737004..29737517 1..514 2495 99 Plus
3R 32079331 3R 29737575..29738071 514..1010 2455 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29477835..29478348 1..514 2495 99 Plus
3R 31820162 3R 29478406..29478902 514..1010 2455 99.5 Plus
Blast to na_te.dros performed on 2019-03-15 12:25:23 has no hits.

GM05702.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:26:01 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25559600..25560113 1..514 99 -> Plus
chr3R 25560172..25560666 515..1009 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:04:15 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 1..891 41..931 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:43 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 1..891 41..931 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:42:39 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 1..891 41..931 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:28 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 1..891 41..931 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:59:13 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 1..891 41..931 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:47 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 35..1043 1..1009 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:42 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 71..1079 1..1009 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:42:39 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 40..1048 1..1009 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:28 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 35..1043 1..1009 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:59:13 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
CG7598-RA 40..1048 1..1009 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:26:01 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29737004..29737517 1..514 99 -> Plus
3R 29737576..29738070 515..1009 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:26:01 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29737004..29737517 1..514 99 -> Plus
3R 29737576..29738070 515..1009 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:26:01 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29737004..29737517 1..514 99 -> Plus
3R 29737576..29738070 515..1009 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:42:39 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25562726..25563239 1..514 99 -> Plus
arm_3R 25563298..25563792 515..1009 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:24 Download gff for GM05702.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29477835..29478348 1..514 99 -> Plus
3R 29478407..29478901 515..1009 99   Plus

GM05702.hyp Sequence

Translation from 40 to 930

> GM05702.hyp
MNSLLRQGLRLGCCLPAVQQQIHTTAVHRTFWEREKKSGYKTKLPEPSKK
QMIMDGLRDLKEEMKLWRQEVKEQFESDPILVFRPGETDVVFDFKAPDVL
DKWTVTTDADHGEGKSTATLELSAAGAGLFHGQVNSDHTKDGIIKRTGYA
NIRTKRVRKSFKRETTYDWTQYNMLVMKVRGDGRSYLINLHTEGYFDLMW
NDIYHYVLYTRGGPHWQIAKIPFSKFFLSSKGRVQDRQGAIPLNRVTHFG
FSVAAKKGMDGPFGLEIDYVGLEYDPSHREEFAYEMYQTPKYIVAT*

GM05702.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG7598-PA 296 CG7598-PA 1..296 1..296 1588 100 Plus

GM05702.pep Sequence

Translation from 40 to 930

> GM05702.pep
MNSLLRQGLRLGCCLPAVQQQIHTTAVHRTFWEREKKSGYKTKLPEPSKK
QMIMDGLRDLKEEMKLWRQEVKEQFESDPILVFRPGETDVVFDFKAPDVL
DKWTVTTDADHGEGKSTATLELSAAGAGLFHGQVNSDHTKDGIIKRTGYA
NIRTKRVRKSFKRETTYDWTQYNMLVMKVRGDGRSYLINLHTEGYFDLMW
NDIYHYVLYTRGGPHWQIAKIPFSKFFLSSKGRVQDRQGAIPLNRVTHFG
FSVAAKKGMDGPFGLEIDYVGLEYDPSHREEFAYEMYQTPKYIVAT*

GM05702.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23368-PA 296 GF23368-PA 1..296 1..296 1497 92.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11688-PA 296 GG11688-PA 1..296 1..296 1573 97 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14323-PA 295 GH14323-PA 1..295 1..296 1447 90.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
CIA30-PA 296 CG7598-PA 1..296 1..296 1588 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10419-PA 294 GI10419-PA 1..294 1..296 1432 89.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13912-PA 295 GL13912-PA 1..295 1..296 1477 92.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20469-PA 295 GA20469-PA 1..295 1..296 1484 92.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12814-PA 296 GM12814-PA 1..296 1..296 1577 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21458-PA 296 GD21458-PA 1..296 1..296 1582 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10635-PA 294 GJ10635-PA 1..294 1..296 1481 92.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11918-PA 298 GK11918-PA 1..298 1..296 1441 89.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23877-PA 296 GE23877-PA 1..296 1..296 1570 97.6 Plus