Clone GM06015 Report

Search the DGRC for GM06015

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:60
Well:15
Vector:pBS SK-
Associated Gene/TranscriptHipHop-RA
Protein status:GM06015.pep: gold
Preliminary Size:1333
Sequenced Size:1107

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6874 2001-01-01 Release 2 assignment
CG6874 2001-10-10 Blastp of sequenced clone
CG6874 2003-01-01 Sim4 clustering to Release 3
l(3)neo26 2008-04-29 Release 5.5 accounting
l(3)neo26 2008-08-15 Release 5.9 accounting
l(3)neo26 2008-12-18 5.12 accounting

Clone Sequence Records

GM06015.complete Sequence

1107 bp (1107 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060915

> GM06015.complete
TAAGCCCGAGTTGTGGAGAACTAGGTGCATGATCTATTTCAGATGGCCTC
CATTGACGAGGGCTCGCGCGTTGAGCGGAGATTCTGCGCAGTCGGCAACC
ACACGCTGCGGAAGCCGTATCGCCAACTGAACAACAAATATTTGGTGCGC
TTCGCCTGTTTGCTGAACAGCGAAATTCGGGCGGGCAACCTCATCTGCTG
CAAGTGCTACACGGACCTGGTGCGACTCTACCGGAAGAAGAACGACAATG
CCAAACGGCACAAGATGGCCAGGGAGACTGCCGCGAGCATTACGGACGTC
AGCGGCAGTCAGTCATCGTCGCACCAAAGTGCGCCCTCTTTGCATGTCTC
TGGCCAAAGTTCCGAATTCGGTGCCTCATACAGTGAGGGGGGCATTGTGA
CTCCCGATGAAGAGCTGTGCTCCCACAGAAGCTTAAGTCAAGATTCAGAC
AATGTGCCTACTACCAGCGCTGCAGCGATCCAAAAACGCCAGCTTGCGAG
GGCAAACCTAATGGTGAAACCATCGCAGAGGCTGAGCTTGGCCCAGACTA
CTCCGGATTGTGACGACTACGACCCCAACTCGAATCTCAGTTTGAACGCC
GTGAATGGCACGCGACTGCCGCACATTCAGCCGATTCCAAAGAGGCGCCC
GACCGTCCTGGACAAGCAGTCCATGGATATTTACTTGATGGGAACCACAG
GTGGTTAGGTGATTTTTTAAGTTGTGACTAGAGAACAAGATACATATGCT
AGTTGATGCTAGTTTCTAAGTTTCATTTAATTAGATATTTTTGTACGCTA
AAATAAAGAAAGACAGAGATGTTAGCTTGGCAGGAGCCACTGAAAGATAG
CCGCCATTTGGAGACTTCCTTGAAGTTTATAATTTTAACATGTTTAATGA
TATTTACATATATTATATGAATGAAGTACATTTATTTTAAAGGCACCACT
GGAAGAGGTTCACAACTTAAGAACTTAAGAAAAATGGAGGCCATAGATAT
TTATTTGGCAGGAGCACCAATAGATAGCCGACTTAGTTTATAACTTAATG
ATGCCGACATTTTCATGAAATTAAAAAAATAAATAACTTAAAAAAAAAAA
AAAAAAA

GM06015.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo26-RB 1090 l(3)neo26-RB 1..1088 1..1095 5180 98.6 Plus
l(3)neo26-RA 1152 l(3)neo26-RA 105..1150 43..1095 4985 98.6 Plus
ms(3)K81-RA 610 ms(3)K81-RA 412..496 565..649 200 82.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18810913..18811995 1..1089 5125 98.6 Plus
chr3R 27901430 chr3R 22699492..22699576 565..649 200 82.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:17:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18821265..18822352 1..1095 5155 98.4 Plus
3R 32079331 3R 26876364..26876448 565..649 200 82.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18814365..18815338 1..973 4755 99.3 Plus
3L 28103327 3L 18815329..18815452 972..1095 575 97.5 Plus
3R 31820162 3R 26617195..26617279 565..649 200 82.3 Plus
Blast to na_te.dros performed 2019-03-16 01:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 2944..3076 1007..877 113 58.7 Minus

GM06015.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:58:33 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18810913..18811995 1..1089 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:04:27 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo26-RB 1..666 43..708 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:45 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
HipHop-RB 1..666 43..708 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:35 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
HipHop-RA 1..666 43..708 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:31 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo26-RB 1..666 43..708 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:53:05 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
HipHop-RA 1..666 43..708 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:50 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo26-RB 1..1082 1..1089 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:45 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
HipHop-RB 1..1082 1..1089 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:35 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
HipHop-RB 95..1176 1..1089 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:31 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo26-RB 1..1082 1..1089 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:53:05 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
HipHop-RB 95..1176 1..1089 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:33 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18821265..18822346 1..1089 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:33 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18821265..18822346 1..1089 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:33 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18821265..18822346 1..1089 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:35 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18814365..18815446 1..1089 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:27 Download gff for GM06015.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18814365..18815446 1..1089 98   Plus

GM06015.pep Sequence

Translation from 42 to 707

> GM06015.pep
MASIDEGSRVERRFCAVGNHTLRKPYRQLNNKYLVRFACLLNSEIRAGNL
ICCKCYTDLVRLYRKKNDNAKRHKMARETAASITDVSGSQSSSHQSAPSL
HVSGQSSEFGASYSEGGIVTPDEELCSHRSLSQDSDNVPTTSAAAIQKRQ
LARANLMVKPSQRLSLAQTTPDCDDYDPNSNLSLNAVNGTRLPHIQPIPK
RRPTVLDKQSMDIYLMGTTGG*

GM06015.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10272-PA 239 GF10272-PA 17..239 14..221 341 40.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13678-PA 225 GG13678-PA 1..225 1..221 903 78.6 Plus
Dere\ms(3)K81-PA 184 GG11507-PA 1..184 4..221 398 47.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13489-PA 199 GH13489-PA 12..199 10..221 293 38.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
HipHop-PB 221 CG6874-PB 1..221 1..221 1145 100 Plus
HipHop-PA 221 CG6874-PA 1..221 1..221 1145 100 Plus
ms(3)K81-PA 184 CG14251-PA 8..184 11..221 396 45.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17239-PA 191 GI17239-PA 149..191 180..221 165 81.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24882-PA 225 GL24882-PA 7..225 6..221 350 43.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19922-PA 225 GA19922-PA 7..225 6..221 352 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14992-PA 227 GM14992-PA 1..227 1..221 1027 86.8 Plus
Dsec\ms(3)K81-PA 183 GM10349-PA 8..183 11..221 363 45.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14769-PA 227 GD14769-PA 1..227 1..221 961 86 Plus
Dsim\ms(3)K81-PA 183 GD21311-PA 8..183 11..221 374 44.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\hiphop-PA 197 GJ17998-PA 14..197 12..221 267 39.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12110-PA 234 GK12110-PA 8..234 12..221 291 37.9 Plus
Dwil\GK15167-PA 173 GK15167-PA 16..88 12..84 146 39.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19974-PA 229 GE19974-PA 1..229 1..221 833 71.9 Plus
Dyak\ms(3)K81-PA 175 GE23697-PA 9..175 11..221 355 45.3 Plus

GM06015.hyp Sequence

Translation from 42 to 707

> GM06015.hyp
MASIDEGSRVERRFCAVGNHTLRKPYRQLNNKYLVRFACLLNSEIRAGNL
ICCKCYTDLVRLYRKKNDNAKRHKMARETAASITDVSGSQSSSHQSAPSL
HVSGQSSEFGASYSEGGIVTPDEELCSHRSLSQDSDNVPTTSAAAIQKRQ
LARANLMVKPSQRLSLAQTTPDCDDYDPNSNLSLNAVNGTRLPHIQPIPK
RRPTVLDKQSMDIYLMGTTGG*

GM06015.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
HipHop-PB 221 CG6874-PB 1..221 1..221 1145 100 Plus
HipHop-PA 221 CG6874-PA 1..221 1..221 1145 100 Plus
ms(3)K81-PA 184 CG14251-PA 8..184 11..221 396 45.8 Plus