Clone GM06185 Report

Search the DGRC for GM06185

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:61
Well:85
Vector:pBS SK-
Associated Gene/TranscriptmRpL50-RA
Protein status:GM06185.pep: gold
Preliminary Size:910
Sequenced Size:717

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14829 2001-01-01 Release 2 assignment
CG8612 2001-01-01 Release 2 assignment
CG8615 2001-01-01 Release 2 assignment
CG8612 2002-03-19 Blastp of sequenced clone
CG8612 2003-01-01 Sim4 clustering to Release 3
mRpL50 2008-04-29 Release 5.5 accounting
mRpL50 2008-08-15 Release 5.9 accounting
mRpL50 2008-12-18 5.12 accounting

Clone Sequence Records

GM06185.complete Sequence

717 bp (717 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094750

> GM06185.complete
CAATGGCAGCGATTTTACGTAAAACCCTAATTCTTGCGGGAAGCCTGCAT
AGGAGTTTTGCCTCCGCCGCCAAGGCCGCAAAAGCAAAGCCCGTCAAAAC
CAGCACCATTTCAGCTGTCGGCGAGTCCATCGCCGCCAAGGGCTTCTTGC
GTCCCCATAAGCCGTACTCCCCACCTGCAGATGCCGCCGAACGTATTCGA
ACCGTAGCCGCCTCGCTTCAACTGAAATCCGACCAGTTGGGGAATCTCTC
CGAGAAATTCGAATTCCTGAACGCGTGCTTCCAGGAGCTGCAGCACGGAG
TGCCCAACTCCCAGGTACATGAACTGCGCACCGTCAGCGATGTTATCGCT
TTCTACCAAACAGCTGTGGACACCACCGTGCCGTTTGATGCACTGAAGCG
CATCGAGCTGCCGGAGAATTTGCACATCCAGTACGAGTACGTGCGATTCC
ATCCCGAGACAGATACCAAATTCGACGGCAAAACGGCTTTCCCCAAGAGC
TCCACCCTAGTCACCGGTCTCAAGTACCGTGGAAAGTACGAGGGACACGA
AGCCAAGCGATCCTGGCCTTAGAAACAGCCAATTGTTAGTTGTTAATGTC
TTACACTTATTAAATGCATTCTGGAAGCCCGAGATTTACGTCATATATAT
TAGGTATTACATTTATTAAATGTTAAATATGCTTAATGGCTAAAATTAAA
AAAAAAAAAAAAAAAAA

GM06185.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL50-RA 777 mRpL50-RA 75..773 1..699 3495 100 Plus
Neos-RA 1523 Neos-RA 1388..1523 699..564 680 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7235239..7235794 697..142 2780 100 Minus
chr3L 24539361 chr3L 7235853..7235962 142..33 550 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:18:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7243078..7243635 699..142 2790 100 Minus
3L 28110227 3L 7243694..7243803 142..33 550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7236178..7236735 699..142 2790 100 Minus
3L 28103327 3L 7236794..7236903 142..33 550 100 Minus
3L 28103327 3L 7236960..7236991 32..1 160 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:07:41 has no hits.

GM06185.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:08:44 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7235239..7235793 143..697 100 <- Minus
chr3L 7235853..7235962 33..142 100 <- Minus
chr3L 7236019..7236050 1..32 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:04:35 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 1..570 3..572 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:30:17 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 1..570 3..572 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:13 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 1..570 3..572 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:03:56 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 1..570 3..572 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:20:00 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 1..570 3..572 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:56:28 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 42..738 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:30:17 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 42..738 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:13 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 43..739 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:03:56 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 42..738 1..697 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:20:00 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL50-RA 43..739 1..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:44 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7243080..7243634 143..697 100 <- Minus
3L 7243694..7243803 33..142 100 <- Minus
3L 7243860..7243891 1..32 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:44 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7243080..7243634 143..697 100 <- Minus
3L 7243694..7243803 33..142 100 <- Minus
3L 7243860..7243891 1..32 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:44 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7243080..7243634 143..697 100 <- Minus
3L 7243694..7243803 33..142 100 <- Minus
3L 7243860..7243891 1..32 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:13 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7236180..7236734 143..697 100 <- Minus
arm_3L 7236794..7236903 33..142 100 <- Minus
arm_3L 7236960..7236991 1..32 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:37:36 Download gff for GM06185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7236960..7236991 1..32 100   Minus
3L 7236180..7236734 143..697 100 <- Minus
3L 7236794..7236903 33..142 100 <- Minus

GM06185.hyp Sequence

Translation from 2 to 571

> GM06185.hyp
MAAILRKTLILAGSLHRSFASAAKAAKAKPVKTSTISAVGESIAAKGFLR
PHKPYSPPADAAERIRTVAASLQLKSDQLGNLSEKFEFLNACFQELQHGV
PNSQVHELRTVSDVIAFYQTAVDTTVPFDALKRIELPENLHIQYEYVRFH
PETDTKFDGKTAFPKSSTLVTGLKYRGKYEGHEAKRSWP*

GM06185.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL50-PA 189 CG8612-PA 1..189 1..189 966 100 Plus

GM06185.pep Sequence

Translation from 2 to 571

> GM06185.pep
MAAILRKTLILAGSLHRSFASAAKAAKAKPVKTSTISAVGESIAAKGFLR
PHKPYSPPADAAERIRTVAASLQLKSDQLGNLSEKFEFLNACFQELQHGV
PNSQVHELRTVSDVIAFYQTAVDTTVPFDALKRIELPENLHIQYEYVRFH
PETDTKFDGKTAFPKSSTLVTGLKYRGKYEGHEAKRSWP*

GM06185.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10571-PA 189 GF10571-PA 1..189 1..189 865 82 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14988-PA 189 GG14988-PA 1..189 1..189 899 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16299-PA 193 GH16299-PA 1..193 1..189 682 66.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL50-PA 189 CG8612-PA 1..189 1..189 966 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13240-PA 193 GI13240-PA 1..193 1..189 714 69.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25235-PA 191 GL25235-PA 1..191 1..189 801 75.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21207-PA 191 GA21207-PA 1..191 1..189 801 75.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13784-PA 189 GM13784-PA 1..189 1..189 973 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13081-PA 189 GD13081-PA 1..189 1..189 971 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12013-PA 193 GJ12013-PA 1..193 1..189 670 69.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25552-PA 185 GK25552-PA 13..185 15..189 649 69.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20434-PA 189 GE20434-PA 1..189 1..189 896 93.7 Plus