Clone GM06533 Report

Search the DGRC for GM06533

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:65
Well:33
Vector:pBS SK-
Associated Gene/TranscriptCG7768-RA
Protein status:GM06533.pep: gold
Preliminary Size:1476
Sequenced Size:1381

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7768 2001-01-01 Release 2 assignment
CG7867 2001-01-01 Release 2 assignment
CG7768 2001-10-10 Blastp of sequenced clone
CG7768 2003-01-01 Sim4 clustering to Release 3
CG7768 2008-04-29 Release 5.5 accounting
CG7768 2008-08-15 Release 5.9 accounting
CG7768 2008-12-18 5.12 accounting

Clone Sequence Records

GM06533.complete Sequence

1381 bp (1381 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060923

> GM06533.complete
AAAGGTAAATATAGCCGGCTTTAAAAGTATCTGTGAGTTTTGCGTTGATT
AAGGCGGCGGTTAAACAAATTAGAAGAGTAAATAAGGTCTGTAAGATTAG
ACACGGATAAAGGTATTTTAAGGACAATATTACCTTAAAATATCCAAATA
TACCGATCATTTGCAATGTATTAAAAATTGTGGAAGCCAAAGCAGGCATT
TTTTTTTGCTACTGGATTTTATAAAGAAGGCTGTGAAATGAATTTCAACG
AGCCCTTACTTCAGATCCCTGACTAGCCCAGAATATTCGTCAGTTCAGTT
CCAGCTGTTCTACTGTACGGTTCTCTTGAAAGTCGTTACCTTTTTTTATC
ATAAAGCTGACACCACCAAGTTATCCGGTAAATATATTTCTTGTTTTTGA
ACAAGGCATCGTTCGATTTTAAACCTAATAGATCTGGCTTTTCTCCGAAA
ATTTTCGGCATCTGCGAAGATGTCGTTGCCACGCGTTTACTTCGATATAG
CCGCAGGAGGTGAGAAGTTAGGTAGAATTGTGATGGAACTACGTTCGGAT
GTGGTGCCCAAGACGGCGGAGAATTTCCGGGCCCTCTGCACCGGAGAGAA
GGGGTACGGCTACAAGGGATCACCATTCCACCGCGTCATCCCGAATTTCA
TGTGTCAGGGCGGTGATTTCACTAATCAAAACGGAACTGGAGGACGCTCC
ATTTATGGAAACAAGTTTCCCGATGAGAATTTCGAGCTAAAGCATACCGG
AGCTGGTGTACTTTCGATGGCCAATGCTGGGGCCAATACCAATGGATCTC
AGTTTTTCATTTGCACCGGGAAAACCACATGGCTGGATAATAAGCATGTC
GTGTTCGGCAAGGTCGTTGAGGGAATGGATATCGTCCAGAAGGTAGAATC
TTACGGTTCACAAGATGGGAAGACCAGCAAGAAAGTAATTATCGAAGACT
GCGGAGCCCTCTGAAGGGTGTCAATACATAATAGTGCTGTCAATCACACA
TTTACACTATTACACTGAAATTATACTTTTCAAGAAAACTTTGCAAAATA
AAAGGGGGTGCAAAAAAATGTATTTTGTCGGTTCAACTATTTACATCGCT
CTCATATGTTACGCATTTCAGACCAATTCGTTGAATAATCCGGTGCACCC
TGAACAGCCCAGTTCCCTGACTCATTTTCCTTTGATTTTTCTTTCCATTA
CTTTTAATTGACTCAATTTAGTTCAAGAGTTGCTCACATATGTCGCTTTT
GATTCTTTCCACTCGATTCTCATTCTGTCTCCCATCACCTTTCCCTCAAG
CCATTCTATCCACTTTACCCGAATGCACTTTGCAAATGTCTATTAAGTCA
CATACACTGATGAAAAAAAAAAAAAAAAAAA

GM06533.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG7768-RB 1382 CG7768-RB 6..1375 1..1370 6835 99.9 Plus
CG7768-RA 717 CG7768-RA 90..717 431..1058 3140 100 Plus
CG7768.a 697 CG7768.a 105..697 469..1061 2965 100 Plus
CG7768.a 697 CG7768.a 1..105 273..377 510 99 Plus
CG7768-RA 717 CG7768-RA 1..90 288..377 435 98.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14208042..14209403 1..1362 6720 99.6 Plus
chrX 22417052 chrX 16207931..16208316 933..548 730 79.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:18:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14217914..14219283 1..1370 6835 99.9 Plus
X 23542271 X 16318213..16318598 933..548 730 79.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14211014..14212383 1..1370 6835 99.9 Plus
X 23527363 X 16326311..16326696 933..548 730 79.2 Minus
Blast to na_te.dros performed 2019-03-16 10:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 4005..4206 263..57 112 56.6 Minus

GM06533.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:10:11 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14208042..14209403 1..1362 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:04:45 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RA 1..495 470..964 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:43:37 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RA 1..495 470..964 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:42 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RA 1..495 470..964 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:12:27 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RA 1..495 470..964 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:19 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RA 1..495 470..964 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:26:13 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RB 6..1367 1..1362 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:43:36 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RA 1..65 312..376 98 == Plus
CG7768-RA 66..696 431..1061 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:42 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RA 1..85 292..376 98 == Plus
CG7768-RA 86..716 431..1061 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:12:27 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RB 6..1367 1..1362 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:19 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
CG7768-RA 1..86 291..376 98 == Plus
CG7768-RA 87..717 431..1061 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:11 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14217914..14219275 1..1362 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:11 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14217914..14219275 1..1362 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:11 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14217914..14219275 1..1362 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:42 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14211014..14212375 1..1362 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:48:56 Download gff for GM06533.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14211014..14212375 1..1362 99   Plus

GM06533.hyp Sequence

Translation from 469 to 963

> GM06533.hyp
MSLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKG
SPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSM
ANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDG
KTSKKVIIEDCGAL*

GM06533.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG7768-PB 164 CG7768-PB 1..164 1..164 875 100 Plus
CG7768-PA 164 CG7768-PA 1..164 1..164 875 100 Plus
Cyp1-PA 227 CG9916-PA 65..227 2..164 752 83.4 Plus
cyp33-PA 300 CG4886-PA 139..299 4..164 625 70.8 Plus
CG2852-PD 205 CG2852-PD 30..190 5..164 480 57.1 Plus

GM06533.pep Sequence

Translation from 469 to 963

> GM06533.pep
MSLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKG
SPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSM
ANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDG
KTSKKVIIEDCGAL*

GM06533.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19040-PA 155 GF19040-PA 1..155 10..164 712 82.6 Plus
Dana\GF11346-PA 394 GF11346-PA 233..393 4..164 616 69.6 Plus
Dana\GF13003-PA 205 GF13003-PA 30..190 5..164 477 56.5 Plus
Dana\GF18880-PA 946 GF18880-PA 11..182 2..164 459 54.1 Plus
Dana\GF13802-PA 183 GF13802-PA 17..183 4..164 445 52.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19332-PA 227 GG19332-PA 65..227 2..164 761 82.2 Plus
Dere\GG21795-PA 300 GG21795-PA 139..299 4..164 613 69.6 Plus
Dere\GG15678-PA 104 GG15678-PA 1..104 61..164 540 98.1 Plus
Dere\GG21776-PA 205 GG21776-PA 30..190 5..164 486 57.1 Plus
Dere\GG10814-PA 183 GG10814-PA 17..183 4..164 444 53.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14843-PA 164 GH14843-PA 1..164 1..164 747 82.9 Plus
Dgri\GH17842-PA 165 GH17842-PA 3..165 2..164 746 80.4 Plus
Dgri\GH14842-PA 164 GH14842-PA 1..164 1..164 744 80.5 Plus
Dgri\GH10794-PA 165 GH10794-PA 3..165 2..164 738 79.1 Plus
Dgri\GH20760-PA 304 GH20760-PA 143..303 4..164 612 69.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG7768-PB 164 CG7768-PB 1..164 1..164 875 100 Plus
CG7768-PA 164 CG7768-PA 1..164 1..164 875 100 Plus
Cyp1-PA 227 CG9916-PA 65..227 2..164 752 83.4 Plus
cyp33-PA 300 CG4886-PA 139..299 4..164 625 70.8 Plus
CG2852-PD 205 CG2852-PD 30..190 5..164 480 57.1 Plus
CG2852-PA 205 CG2852-PA 30..190 5..164 480 57.1 Plus
Moca-cyp-PA 970 CG1866-PA 13..182 4..164 454 54.7 Plus
CG17266-PB 183 CG17266-PB 17..183 4..164 443 53.3 Plus
CG17266-PA 183 CG17266-PA 17..183 4..164 443 53.3 Plus
CG8336-PD 383 CG8336-PD 15..183 4..164 396 48.5 Plus
CG8336-PC 383 CG8336-PC 15..183 4..164 396 48.5 Plus
CG8336-PA 383 CG8336-PA 15..183 4..164 396 48.5 Plus
CG8336-PB 383 CG8336-PB 15..183 4..164 396 48.5 Plus
ninaA-PA 237 CG3966-PA 28..191 5..164 358 45.1 Plus
Cypl-PA 176 CG13892-PA 29..151 17..142 312 51.2 Plus
CG3511-PB 637 CG3511-PB 479..612 5..142 295 51.1 Plus
CG3511-PA 637 CG3511-PA 479..612 5..142 295 51.1 Plus
CG7747-PA 517 CG7747-PA 288..412 17..144 294 51.9 Plus
CG11777-PA 161 CG11777-PA 9..132 17..143 248 45.3 Plus
CG10907-PA 502 CG10907-PA 21..133 17..132 237 46.2 Plus
CG5071-PD 680 CG5071-PD 514..674 4..162 220 31.1 Plus
CG5071-PB 680 CG5071-PB 514..674 4..162 220 31.1 Plus
CG5808-PA 653 CG5808-PA 9..164 17..160 173 33.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13614-PA 164 GI13614-PA 1..164 1..164 790 90.2 Plus
Dmoj\GI13698-PA 165 GI13698-PA 3..165 2..164 789 89 Plus
Dmoj\GI21755-PA 165 GI21755-PA 3..165 2..164 770 84.7 Plus
Dmoj\GI13696-PA 166 GI13696-PA 1..164 1..164 761 82.9 Plus
Dmoj\GI20843-PA 303 GI20843-PA 142..302 4..164 618 70.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11464-PA 302 GL11464-PA 141..301 4..164 617 70.2 Plus
Dper\GL17482-PA 205 GL17482-PA 30..190 5..164 478 56.8 Plus
Dper\GL23654-PA 939 GL23654-PA 13..182 4..164 454 52.9 Plus
Dper\GL10991-PA 183 GL10991-PA 17..183 4..164 438 52.1 Plus
Dper\GL12709-PA 384 GL12709-PA 15..183 4..164 385 49.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Cyp1-PA 226 GA22120-PA 64..226 2..164 755 82.2 Plus
Dpse\GA18502-PA 302 GA18502-PA 141..301 4..164 618 70.2 Plus
Dpse\GA15486-PA 205 GA15486-PA 30..190 5..164 478 56.8 Plus
Dpse\GA15038-PA 930 GA15038-PA 13..182 4..164 458 53.5 Plus
Dpse\GA14426-PA 183 GA14426-PA 17..183 4..164 438 52.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25460-PA 164 GM25460-PA 1..164 1..164 861 98.2 Plus
Dsec\GM13410-PA 227 GM13410-PA 65..227 2..164 765 83.4 Plus
Dsec\GM21798-PA 301 GM21798-PA 140..300 4..164 625 71.4 Plus
Dsec\GM15627-PA 205 GM15627-PA 30..190 5..164 486 57.1 Plus
Dsec\GM20863-PA 183 GM20863-PA 17..183 4..164 444 53.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20227-PA 155 GD20227-PA 1..155 10..164 697 81.9 Plus
Dsim\GD11288-PA 301 GD11288-PA 140..300 4..164 625 71.4 Plus
Dsim\GD25116-PA 203 GD25116-PA 28..188 5..164 486 57.1 Plus
Dsim\GD21371-PA 1003 GD21371-PA 13..182 4..164 461 54.7 Plus
Dsim\GD10314-PA 183 GD10314-PA 17..183 4..164 444 53.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14038-PA 164 GJ14038-PA 1..164 1..164 790 88.4 Plus
Dvir\GJ13951-PA 164 GJ13951-PA 1..164 1..164 788 89 Plus
Dvir\GJ19133-PA 223 GJ19133-PA 61..223 2..164 765 82.2 Plus
Dvir\GJ14037-PA 164 GJ14037-PA 1..164 1..164 762 84.1 Plus
Dvir\GJ20579-PA 302 GJ20579-PA 141..301 4..164 614 70.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16511-PA 165 GK16511-PA 3..165 2..164 734 81 Plus
Dwil\GK14585-PA 165 GK14585-PA 4..165 3..164 719 79.6 Plus
Dwil\GK21428-PA 204 GK21428-PA 29..189 5..164 483 57.1 Plus
Dwil\GK12144-PA 847 GK12144-PA 13..176 4..164 446 54.3 Plus
Dwil\GK23148-PA 183 GK23148-PA 17..183 4..164 443 52.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22008-PA 180 GE22008-PA 17..180 1..164 868 98.8 Plus
Dyak\Cyp1-PA 227 GE15979-PA 65..227 2..164 761 82.2 Plus
Dyak\GE11871-PA 300 GE11871-PA 139..299 4..164 614 69.6 Plus
Dyak\GE11851-PA 205 GE11851-PA 30..190 5..164 485 56.5 Plus
Dyak\GE24621-PA 183 GE24621-PA 17..183 4..164 444 53.3 Plus