Clone GM06937 Report

Search the DGRC for GM06937

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:69
Well:37
Vector:pBS SK-
Associated Gene/TranscriptCG30196-RA
Protein status:GM06937.pep: gold
Preliminary Size:712
Sequenced Size:502

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30196-RA 2009-01-21 est gleaning
CG30196 2009-06-05 Manual selection by Joe Carlson

Clone Sequence Records

GM06937.complete Sequence

502 bp assembled on 2009-07-28

GenBank Submission: BT088968.1

> GM06937.complete
CGAAATGGCCAGCACCGAGAGTCTGGATGGCAGTGCCTTCGAGGGGGACA
TCTCATCCATTCCGCAAGTGGGCCATCTGACCACAGAGCCCCAGGAGTTG
GAGTGTCCAGCCTGCCAGCAGTTGCAGACTACCCACGTGAAATCGGAGGC
AGTGACCGTTCTGCAGAAGATTGCCTGCTCGCTGAATGTGCTTCTCTGCT
GTAACCCCATTCGCTGGAAGGGCCGTCATGATGTCAATCACTACTGCAGC
TCCTGTGGCTGTTTCATTGGACGCGACATCACTCTGAGTTGGTACAAGAG
GACCCTCTTTCGGCTGCAACGGGGAGAGGTGGAGGATAACGGACGCTGGC
AGAGATTCCGCAAGGTGGAGAAGGAGCAGCTGGACGAGAAAAAACTTGGC
AGACAGCGCAAGGCCATCGAATCGAAGCGTTCCAATGAGAATTATTAAAT
AAATTTAAGCAATATTAGCTCCTGTGCTAAAAAAAAAAAAAAAAAAAAAA
AA

GM06937.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG30196-RA 619 CG30196-RA 132..611 1..480 2340 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18541369..18541646 478..201 1360 99.3 Minus
chr2R 21145070 chr2R 18541738..18541938 201..1 990 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:18:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22654803..22655082 480..201 1355 98.9 Minus
2R 25286936 2R 22655174..22655374 201..1 990 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22656002..22656281 480..201 1355 98.9 Minus
2R 25260384 2R 22656373..22656573 201..1 990 99.5 Minus
Blast to na_te.dros performed on 2019-03-15 15:05:53 has no hits.

GM06937.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:06:48 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18541369..18541645 202..478 99 <- Minus
chr2R 18541738..18541938 1..201 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:03 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
CG30196-RA 1..444 5..448 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:33 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
CG30196-RA 1..444 5..448 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:02:22 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
CG30196-RA 1..444 5..448 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:48 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
CG30196-RA 1..444 5..448 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 16:32:18 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
CG30196-RA 18..495 1..478 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:33 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
CG30196-RA 18..495 1..478 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:02:22 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
CG30196-RA 19..496 1..478 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:48 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
CG30196-RA 19..496 1..478 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:06:48 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22654805..22655081 202..478 98 <- Minus
2R 22655174..22655374 1..201 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:06:48 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22654805..22655081 202..478 98 <- Minus
2R 22655174..22655374 1..201 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:06:48 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22654805..22655081 202..478 98 <- Minus
2R 22655174..22655374 1..201 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:02:22 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18542310..18542586 202..478 98 <- Minus
arm_2R 18542679..18542879 1..201 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:26 Download gff for GM06937.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22656004..22656280 202..478 98 <- Minus
2R 22656373..22656573 1..201 99   Minus

GM06937.hyp Sequence

Translation from 0 to 447

> GM06937.hyp
EMASTESLDGSAFEGDISSIPQVGHLTTEPQELECPACQQLQTTHVKSEA
VTVLQKIACSLNVLLCCNPIRWKGRHDVNHYCSSCGCFIGRDITLSWYKR
TLFRLQRGEVEDNGRWQRFRKVEKEQLDEKKLGRQRKAIESKRSNENY*

GM06937.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG30196-PA 147 CG30196-PA 1..147 2..148 790 100 Plus
CG30195-PA 153 CG30195-PA 13..137 17..146 203 34.6 Plus

GM06937.pep Sequence

Translation from 1 to 447

> GM06937.pep
EMASTESLDGSAFEGDISSIPQVGHLTTEPQELECPACQQLQTTHVKSEA
VTVLQKIACSLNVLLCCNPIRWKGRHDVNHYCSSCGCFIGRDITLSWYKR
TLFRLQRGEVEDNGRWQRFRKVEKEQLDEKKLGRQRKAIESKRSNENY*

GM06937.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13577-PA 125 GF13577-PA 1..118 2..121 508 79.2 Plus
Dana\GF13581-PA 153 GF13581-PA 13..98 17..107 171 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21770-PA 147 GG21770-PA 1..147 2..148 772 97.3 Plus
Dere\GG21775-PA 153 GG21775-PA 12..101 16..110 191 41.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22102-PA 144 GH22102-PA 3..141 2..139 575 75.5 Plus
Dgri\GH22106-PA 147 GH22106-PA 18..126 21..147 181 34.9 Plus
Dgri\GH12597-PA 147 GH12597-PA 18..126 21..147 181 34.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG30196-PA 147 CG30196-PA 1..147 2..148 790 100 Plus
CG30195-PA 153 CG30195-PA 13..137 17..146 203 34.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19237-PA 142 GI19237-PA 1..139 2..139 570 77.1 Plus
Dmoj\GI19241-PA 151 GI19241-PA 20..99 23..107 194 44.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10714-PA 148 GL10714-PA 1..143 2..140 622 79.7 Plus
Dper\GL10718-PA 179 GL10718-PA 13..93 17..102 177 44.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24453-PA 148 GA24453-PA 1..143 2..140 622 79.7 Plus
Dpse\GA15720-PA 179 GA15720-PA 13..93 17..102 177 44.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15618-PA 147 GM15618-PA 1..147 2..148 784 99.3 Plus
Dsec\GM15626-PA 153 GM15626-PA 13..137 17..146 196 34.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25112-PA 147 GD25112-PA 1..147 2..148 779 98.6 Plus
Dsim\GD25115-PA 153 GD25115-PA 13..101 17..110 194 42.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20312-PA 126 GJ20312-PA 1..124 2..140 471 68.6 Plus
Dvir\GJ20317-PA 155 GJ20317-PA 18..110 21..117 196 41.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21850-PA 149 GK21850-PA 1..139 2..139 558 74.1 Plus
Dwil\GK21854-PA 152 GK21854-PA 13..105 17..112 156 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11845-PA 147 GE11845-PA 1..147 2..148 749 93.9 Plus
Dyak\GE11850-PA 153 GE11850-PA 12..101 16..110 194 42.1 Plus