Clone GM08271 Report

Search the DGRC for GM08271

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:82
Well:71
Vector:pBS SK-
Associated Gene/TranscriptCG5919-RA
Protein status:GM08271.pep: gold
Preliminary Size:1111
Sequenced Size:927

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5919 2001-01-01 Release 2 assignment
CG5919 2002-05-17 Blastp of sequenced clone
CG5919 2003-01-01 Sim4 clustering to Release 3
CG5919 2008-04-29 Release 5.5 accounting
CG5919 2008-08-15 Release 5.9 accounting
CG5919 2008-12-18 5.12 accounting

Clone Sequence Records

GM08271.complete Sequence

927 bp (927 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118469

> GM08271.complete
GCAGACCCGCGCGCTGTATTACGAAGTTTCACTTTCATATTTGTTTTGGC
CACCACTCCAAACTAGTCATTTACCAAAAATGTTGGCCTCTCGCTTGAAT
CTCCTGTTGCCCCGCGTATCCTGGCTGCGCGGTTGCTCAACGACAGCGGT
GGGCCAGAAACATCAGCGCCAGGTGCCCACGGAGTTCGCCGTACACGATC
CTCTGCAGGCTCACGCTCTAAAGGAACAGTGCATCCTGGTTGACGCCAAC
GACCAAGCCATTGGGGCCGCCTCTAAGGCAGACTGCCACCGTGTGCATCC
AGAGACGAATGATGTTAAGCTCCATCGCGCCTTCAGTGTTTTTCTCTTCA
ATTCTCAGGGAGAGATGCTAGTGCAGAAGCGATCGTCTCACAAGATAACC
TTCCCAAACACCTACACCAACGCGTGCTGCAGCCATCCGCTTTACGAAAT
CGAACAGGAACGTCAGGAGCGCAACGCACAGGGCATCCGTGTGGCCGCTC
AACGACGTCTCAACTACGAACTGGGCATTCCCACAGAGGAACTGCAGCCA
CAGGACTTTCGCTACCTGACCCGCATCCACTACGCAGACACGGGCGACGG
CGTGTGGGGCGAGCACGAGATAGACTACATCCTGTTCCTGCAAAAAGACG
TGACGCTGCGTCCAAATAGCAACGAGGTCAGTGAGGTGCGCTACTTGCGC
CGCGATAAGATCGACGAGGCGGTGGCGAAGTTTAGTGCCCCGCTGACACC
CTGGTTCTCTCTGATTCTGCAGCATCGATTGAAACTCTGGTGGGACAATT
TGCACCAGCTGGAGCAATTTGAGGACTTGAGTAATATTCAGCGCTTTTAA
GTGTGCTAACCAACCAAAAATACACGTAATGACGTCTAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA

GM08271.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG5919-RB 1332 CG5919-RB 55..945 1..891 4455 100 Plus
CG5919-RA 1332 CG5919-RA 55..945 1..891 4455 100 Plus
CG5919.a 1236 CG5919.a 55..730 1..676 3380 100 Plus
CG5919.a 1236 CG5919.a 729..849 771..891 605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17094414..17094908 393..887 2475 100 Plus
chr3R 27901430 chr3R 17093966..17094359 1..394 1970 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:19:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21270585..21271083 393..891 2495 100 Plus
3R 32079331 3R 21270137..21270530 1..394 1970 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21011416..21011914 393..891 2495 100 Plus
3R 31820162 3R 21010968..21011361 1..394 1970 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:47:30 has no hits.

GM08271.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:48:06 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17093966..17094359 1..394 100 -> Plus
chr3R 17094416..17094908 395..887 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:05:30 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RA 1..771 80..850 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:49:23 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RB 1..771 80..850 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:09:25 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RA 1..771 80..850 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:42:02 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RA 1..771 80..850 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:55:53 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RA 1..771 80..850 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:26:22 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RA 1..887 1..887 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:49:22 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RA 1..887 1..887 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:09:25 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RA 12..898 1..887 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:42:02 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RA 1..887 1..887 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:55:53 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
CG5919-RA 12..898 1..887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:48:06 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21270137..21270530 1..394 100 -> Plus
3R 21270587..21271079 395..887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:48:06 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21270137..21270530 1..394 100 -> Plus
3R 21270587..21271079 395..887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:48:06 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21270137..21270530 1..394 100 -> Plus
3R 21270587..21271079 395..887 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:09:25 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17095859..17096252 1..394 100 -> Plus
arm_3R 17096309..17096801 395..887 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:14:16 Download gff for GM08271.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21010968..21011361 1..394 100 -> Plus
3R 21011418..21011910 395..887 100   Plus

GM08271.hyp Sequence

Translation from 0 to 849

> GM08271.hyp
QTRALYYEVSLSYLFWPPLQTSHLPKMLASRLNLLLPRVSWLRGCSTTAV
GQKHQRQVPTEFAVHDPLQAHALKEQCILVDANDQAIGAASKADCHRVHP
ETNDVKLHRAFSVFLFNSQGEMLVQKRSSHKITFPNTYTNACCSHPLYEI
EQERQERNAQGIRVAAQRRLNYELGIPTEELQPQDFRYLTRIHYADTGDG
VWGEHEIDYILFLQKDVTLRPNSNEVSEVRYLRRDKIDEAVAKFSAPLTP
WFSLILQHRLKLWWDNLHQLEQFEDLSNIQRF*

GM08271.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5919-PB 256 CG5919-PB 1..256 27..282 1359 100 Plus
CG5919-PA 256 CG5919-PA 1..256 27..282 1359 100 Plus

GM08271.pep Sequence

Translation from 79 to 849

> GM08271.pep
MLASRLNLLLPRVSWLRGCSTTAVGQKHQRQVPTEFAVHDPLQAHALKEQ
CILVDANDQAIGAASKADCHRVHPETNDVKLHRAFSVFLFNSQGEMLVQK
RSSHKITFPNTYTNACCSHPLYEIEQERQERNAQGIRVAAQRRLNYELGI
PTEELQPQDFRYLTRIHYADTGDGVWGEHEIDYILFLQKDVTLRPNSNEV
SEVRYLRRDKIDEAVAKFSAPLTPWFSLILQHRLKLWWDNLHQLEQFEDL
SNIQRF*

GM08271.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17702-PA 258 GF17702-PA 1..258 1..256 1161 84.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24520-PA 256 GG24520-PA 1..256 1..256 1345 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21955-PA 253 GH21955-PA 1..253 1..256 1106 78.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Idi-PB 256 CG5919-PB 1..256 1..256 1359 100 Plus
Idi-PA 256 CG5919-PA 1..256 1..256 1359 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21943-PA 251 GI21943-PA 1..251 1..256 1067 76.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27329-PA 252 GL27329-PA 1..252 1..256 1097 80.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19228-PA 252 GA19228-PA 1..252 1..256 1097 80.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15083-PA 256 GM15083-PA 1..256 1..256 1349 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19412-PA 256 GD19412-PA 1..256 1..256 1348 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14302-PA 251 GJ14302-PA 1..251 1..256 1095 78.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14497-PA 252 GK14497-PA 1..252 1..256 1065 76.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25722-PA 256 GE25722-PA 1..256 1..256 1317 94.9 Plus