BDGP Sequence Production Resources |
Search the DGRC for GM08654
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 86 |
Well: | 54 |
Vector: | pBS SK- |
Associated Gene/Transcript | CG12107-RA |
Protein status: | GM08654.pep: gold |
Preliminary Size: | 941 |
Sequenced Size: | 738 |
Gene | Date | Evidence |
---|---|---|
CG12107 | 2001-01-01 | Release 2 assignment |
CG12107 | 2002-03-19 | Blastp of sequenced clone |
CG12107 | 2003-01-01 | Sim4 clustering to Release 3 |
CG12107 | 2008-04-29 | Release 5.5 accounting |
CG12107 | 2008-08-15 | Release 5.9 accounting |
CG12107 | 2008-12-18 | 5.12 accounting |
738 bp (738 high quality bases) assembled on 2002-03-19
GenBank Submission: AY094757
> GM08654.complete AAATAATTTAAACTCATTTGGGTCAGATTTTAATTAAGCTATGGCGACGA AAACAAATACCATCGAGCGCAACGGCCACTCGGCCAAAAGCTCCACACTA CGGGAAATTTGCGCGCGCGCCATCACAAAATCGGAGTGGGAGGACAAGGA AGAGTTCCTGGACGTTATCTACTGGTCACGCCAGGTATTCGGCATCTTTC TGGGCGTCATCTGGGGCATTGTTCCGCTGAAGGGCTTTCTGGGCCTCGTA CTATTCGCCGGCATCAGCTGCGGGATCGTCTACCTGTACGCCATAAACTT TCAGAACGTGGACGAGGACGCCTACGGAGGGGTATGGGAGCTGATCAAGG AGGGGTTCATGACGTCGTTTGCCGGATTCCTGGTCACGTGGATCATCTTC TACACGGGCCTGCACTACGACGCCATAATGGCGGCGAAAGGATCTTAATA ACACTCCCCAGCAATACCGGATTCCAGGAGCCAGGTCCACACCACACCAC TCCACTCTCCACATAAGCCAGCAGCTCCTCTCGTTTTGTGTCCCCTTTGT ACTCGCTGTAGATTGTTAAACTTTTAGCCAATTACGGTCATGTAAATGCA TTTCTGTTGTGACCGATTGTCCCGAATCTTTCCGTGAAAGATCCTTCGGC CAGCGGTCTTAGTTGAAAACAGAAGATTCTATATGTTTTTGAGTGTCCGA AATGCAGAATGCGATGAATCAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12107-RA | 880 | CG12107-RA | 68..789 | 1..722 | 3565 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 3562202..3562669 | 253..720 | 2340 | 100 | Plus |
chr2R | 21145070 | chr2R | 3561819..3561967 | 1..149 | 715 | 98.7 | Plus |
chr2R | 21145070 | chr2R | 3562026..3562131 | 147..252 | 530 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 3561832..3561966 | 14..148 | 99 | -> | Plus |
chr2R | 3562028..3562131 | 149..252 | 100 | -> | Plus |
chr2R | 3562202..3562669 | 253..720 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 1..408 | 41..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 1..408 | 41..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 1..408 | 41..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 1..408 | 41..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 1..408 | 41..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 60..779 | 1..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 67..786 | 1..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 63..782 | 1..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 60..779 | 1..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12107-RA | 63..782 | 1..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7674512..7674659 | 1..148 | 98 | -> | Plus |
2R | 7674721..7674824 | 149..252 | 100 | -> | Plus |
2R | 7674895..7675362 | 253..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7674512..7674659 | 1..148 | 98 | -> | Plus |
2R | 7674721..7674824 | 149..252 | 100 | -> | Plus |
2R | 7674895..7675362 | 253..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7674512..7674659 | 1..148 | 98 | -> | Plus |
2R | 7674721..7674824 | 149..252 | 100 | -> | Plus |
2R | 7674895..7675362 | 253..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 3562017..3562164 | 1..148 | 98 | -> | Plus |
arm_2R | 3562226..3562329 | 149..252 | 100 | -> | Plus |
arm_2R | 3562400..3562867 | 253..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7676094..7676561 | 253..720 | 99 | Plus | |
2R | 7675711..7675858 | 1..148 | 98 | -> | Plus |
2R | 7675920..7676023 | 149..252 | 100 | -> | Plus |
Translation from 40 to 447
> GM08654.pep MATKTNTIERNGHSAKSSTLREICARAITKSEWEDKEEFLDVIYWSRQVF GIFLGVIWGIVPLKGFLGLVLFAGISCGIVYLYAINFQNVDEDAYGGVWE LIKEGFMTSFAGFLVTWIIFYTGLHYDAIMAAKGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13194-PA | 136 | GF13194-PA | 1..136 | 1..135 | 666 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23296-PA | 135 | GG23296-PA | 1..135 | 1..135 | 689 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21884-PA | 136 | GH21884-PA | 1..136 | 1..135 | 638 | 87.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12107-PA | 135 | CG12107-PA | 1..135 | 1..135 | 713 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20383-PA | 136 | GI20383-PA | 1..136 | 1..135 | 587 | 88.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10523-PA | 154 | GL10523-PA | 1..79 | 1..78 | 366 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11400-PA | 136 | GA11400-PA | 1..136 | 1..135 | 649 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20973-PA | 135 | GM20973-PA | 1..135 | 1..135 | 700 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10503-PA | 135 | GD10503-PA | 1..135 | 1..135 | 704 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22108-PA | 136 | GJ22108-PA | 1..136 | 1..135 | 593 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19477-PA | 139 | GK19477-PA | 1..133 | 1..133 | 573 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19142-PA | 135 | GE19142-PA | 1..135 | 1..135 | 694 | 97.8 | Plus |
Translation from 40 to 447
> GM08654.hyp MATKTNTIERNGHSAKSSTLREICARAITKSEWEDKEEFLDVIYWSRQVF GIFLGVIWGIVPLKGFLGLVLFAGISCGIVYLYAINFQNVDEDAYGGVWE LIKEGFMTSFAGFLVTWIIFYTGLHYDAIMAAKGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12107-PA | 135 | CG12107-PA | 1..135 | 1..135 | 713 | 100 | Plus |