Clone GM08654 Report

Search the DGRC for GM08654

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:86
Well:54
Vector:pBS SK-
Associated Gene/TranscriptCG12107-RA
Protein status:GM08654.pep: gold
Preliminary Size:941
Sequenced Size:738

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12107 2001-01-01 Release 2 assignment
CG12107 2002-03-19 Blastp of sequenced clone
CG12107 2003-01-01 Sim4 clustering to Release 3
CG12107 2008-04-29 Release 5.5 accounting
CG12107 2008-08-15 Release 5.9 accounting
CG12107 2008-12-18 5.12 accounting

Clone Sequence Records

GM08654.complete Sequence

738 bp (738 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094757

> GM08654.complete
AAATAATTTAAACTCATTTGGGTCAGATTTTAATTAAGCTATGGCGACGA
AAACAAATACCATCGAGCGCAACGGCCACTCGGCCAAAAGCTCCACACTA
CGGGAAATTTGCGCGCGCGCCATCACAAAATCGGAGTGGGAGGACAAGGA
AGAGTTCCTGGACGTTATCTACTGGTCACGCCAGGTATTCGGCATCTTTC
TGGGCGTCATCTGGGGCATTGTTCCGCTGAAGGGCTTTCTGGGCCTCGTA
CTATTCGCCGGCATCAGCTGCGGGATCGTCTACCTGTACGCCATAAACTT
TCAGAACGTGGACGAGGACGCCTACGGAGGGGTATGGGAGCTGATCAAGG
AGGGGTTCATGACGTCGTTTGCCGGATTCCTGGTCACGTGGATCATCTTC
TACACGGGCCTGCACTACGACGCCATAATGGCGGCGAAAGGATCTTAATA
ACACTCCCCAGCAATACCGGATTCCAGGAGCCAGGTCCACACCACACCAC
TCCACTCTCCACATAAGCCAGCAGCTCCTCTCGTTTTGTGTCCCCTTTGT
ACTCGCTGTAGATTGTTAAACTTTTAGCCAATTACGGTCATGTAAATGCA
TTTCTGTTGTGACCGATTGTCCCGAATCTTTCCGTGAAAGATCCTTCGGC
CAGCGGTCTTAGTTGAAAACAGAAGATTCTATATGTTTTTGAGTGTCCGA
AATGCAGAATGCGATGAATCAAAAAAAAAAAAAAAAAA

GM08654.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-RA 880 CG12107-RA 68..789 1..722 3565 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3562202..3562669 253..720 2340 100 Plus
chr2R 21145070 chr2R 3561819..3561967 1..149 715 98.7 Plus
chr2R 21145070 chr2R 3562026..3562131 147..252 530 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:19:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7674895..7675364 253..722 2335 99.8 Plus
2R 25286936 2R 7674512..7674660 1..149 715 98.7 Plus
2R 25286936 2R 7674719..7674824 147..252 530 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7676094..7676563 253..722 2335 99.7 Plus
2R 25260384 2R 7675711..7675859 1..149 715 98.6 Plus
2R 25260384 2R 7675918..7676023 147..252 530 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:31:36 has no hits.

GM08654.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:32:26 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3561832..3561966 14..148 99 -> Plus
chr2R 3562028..3562131 149..252 100 -> Plus
chr2R 3562202..3562669 253..720 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:05:45 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 1..408 41..448 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:30:01 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 1..408 41..448 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:51:42 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 1..408 41..448 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:03:48 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 1..408 41..448 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:40 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 1..408 41..448 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:56:16 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 60..779 1..720 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:30:01 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 67..786 1..720 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:51:42 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 63..782 1..720 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:41 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 60..779 1..720 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:40 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 63..782 1..720 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:26 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7674512..7674659 1..148 98 -> Plus
2R 7674721..7674824 149..252 100 -> Plus
2R 7674895..7675362 253..720 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:26 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7674512..7674659 1..148 98 -> Plus
2R 7674721..7674824 149..252 100 -> Plus
2R 7674895..7675362 253..720 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:26 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7674512..7674659 1..148 98 -> Plus
2R 7674721..7674824 149..252 100 -> Plus
2R 7674895..7675362 253..720 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:51:42 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3562017..3562164 1..148 98 -> Plus
arm_2R 3562226..3562329 149..252 100 -> Plus
arm_2R 3562400..3562867 253..720 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:37:26 Download gff for GM08654.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7676094..7676561 253..720 99   Plus
2R 7675711..7675858 1..148 98 -> Plus
2R 7675920..7676023 149..252 100 -> Plus

GM08654.pep Sequence

Translation from 40 to 447

> GM08654.pep
MATKTNTIERNGHSAKSSTLREICARAITKSEWEDKEEFLDVIYWSRQVF
GIFLGVIWGIVPLKGFLGLVLFAGISCGIVYLYAINFQNVDEDAYGGVWE
LIKEGFMTSFAGFLVTWIIFYTGLHYDAIMAAKGS*

GM08654.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13194-PA 136 GF13194-PA 1..136 1..135 666 94.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23296-PA 135 GG23296-PA 1..135 1..135 689 97 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21884-PA 136 GH21884-PA 1..136 1..135 638 87.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-PA 135 CG12107-PA 1..135 1..135 713 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20383-PA 136 GI20383-PA 1..136 1..135 587 88.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10523-PA 154 GL10523-PA 1..79 1..78 366 91.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11400-PA 136 GA11400-PA 1..136 1..135 649 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20973-PA 135 GM20973-PA 1..135 1..135 700 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10503-PA 135 GD10503-PA 1..135 1..135 704 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22108-PA 136 GJ22108-PA 1..136 1..135 593 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19477-PA 139 GK19477-PA 1..133 1..133 573 88 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19142-PA 135 GE19142-PA 1..135 1..135 694 97.8 Plus

GM08654.hyp Sequence

Translation from 40 to 447

> GM08654.hyp
MATKTNTIERNGHSAKSSTLREICARAITKSEWEDKEEFLDVIYWSRQVF
GIFLGVIWGIVPLKGFLGLVLFAGISCGIVYLYAINFQNVDEDAYGGVWE
LIKEGFMTSFAGFLVTWIIFYTGLHYDAIMAAKGS*

GM08654.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-PA 135 CG12107-PA 1..135 1..135 713 100 Plus