Clone GM08921 Report

Search the DGRC for GM08921

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:89
Well:21
Vector:pBS SK-
Associated Gene/TranscriptNtf-2-RA
Protein status:GM08921.pep: gold
Preliminary Size:934
Sequenced Size:747

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1740 2001-01-01 Release 2 assignment
CG1740 2002-03-19 Blastp of sequenced clone
CG10174 2003-01-01 Sim4 clustering to Release 3
CG1740 2003-01-01 Sim4 clustering to Release 3
Ntf-2 2008-04-29 Release 5.5 accounting
Ntf-2 2008-08-15 Release 5.9 accounting
Ntf-2 2008-12-18 5.12 accounting

Clone Sequence Records

GM08921.complete Sequence

747 bp (747 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094761

> GM08921.complete
TGATCTGAGCGCAGTCGGTTGATTTCATTTGGTTTTTTTTTTAATTATTC
GTGTCGCCGCGATCGGATCGGATTTCCCATAATCTCTGAGCGTTCCGCCT
ATCCTTCAAGTGAAATGTCGCTGAATCCGCAGTACGAGGACATTGGCAAG
GGATTTGTGCAGCAGTACTATGCGATATTCGATGACCCGGCGAATCGGGC
GAACGTGGTTAATTTCTATAGCGCTACCGACTCATTCATGACCTTTGAAG
GCCACCAAATACAGGGGGCACCCAAGATTCTGGAAAAAGTTCAGAGTCTG
AGCTTTCAGAAGATTACCAGAGTGATAACCACAGTGGACTCGCAGCCAAC
TTTCGATGGCGGAGTTCTGATCAACGTCCTTGGAAGACTACAGTGCGATG
ACGATCCCCCACATGCCTTCTCGCAGGTCTTTTTCCTGAAGGCCAACGCA
GGCACCTTCTTTGTGGCCCACGACATCTTCCGTCTCAACATCCACAACTC
TGCCTAGGAGCACTCCACTTACCTACGTATGCACACCACTCAGCACCACA
CATAATCGACATCCAAAGATGCCCAGCGCCAGATGATAACAACAAGCTCG
GCAGTGGAACTCAGAAAAAAAAAATATAACAAAGCCAGCCAGCGGTCTCA
CGATTATCAGCAAATACAAAAGTTAGAAAAAGAAAAAAAAAAAAAAAACA
ATAAAAAAATAAGAAAATAACGCTAAAAAAAAAAAAAAAAAAAAAAA

GM08921.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-RA 1297 Ntf-2-RA 106..831 1..726 3630 100 Plus
Ntf-2-RB 670 Ntf-2-RB 106..523 1..418 1985 98.3 Plus
Ntf-2r-RA 698 Ntf-2r-RA 31..448 100..517 1595 92.1 Plus
Ntf-2r-RA 698 Ntf-2r-RA 511..619 583..695 245 84 Plus
Ntf-2r-RA 698 Ntf-2r-RA 461..497 544..580 170 97.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20903900..20904233 391..724 1670 100 Plus
chr2L 23010047 chr2L 18453450..18454038 100..695 1635 86.2 Plus
chrX 22417052 chrX 20900657..20900879 1..223 1115 100 Plus
chrX 22417052 chrX 20901693..20901794 292..393 510 100 Plus
chrX 22417052 chrX 20901556..20901627 223..294 360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:20:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21038743..21039078 391..726 1680 100 Plus
2L 23513712 2L 18454752..18455340 100..695 1635 86.2 Plus
X 23542271 X 21035500..21035722 1..223 1115 100 Plus
X 23542271 X 21036536..21036637 292..393 510 100 Plus
X 23542271 X 21036399..21036470 223..294 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21023835..21024170 391..726 1680 100 Plus
2L 23513712 2L 18454752..18455169 100..517 1595 92.1 Plus
X 23527363 X 21020592..21020814 1..223 1115 100 Plus
X 23527363 X 21021628..21021729 292..393 510 100 Plus
X 23527363 X 21021491..21021562 223..294 360 100 Plus
2L 23513712 2L 18455232..18455340 583..695 245 84 Plus
2L 23513712 2L 18455182..18455218 544..580 170 97.2 Plus
Blast to na_te.dros performed 2019-03-15 19:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
BS3 1790 BS3 BS3 1790bp 1638..1692 721..666 115 69.6 Minus

GM08921.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:12:32 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20900657..20900878 1..222 100 -> Plus
chrX 20901556..20901627 223..294 100 -> Plus
chrX 20901696..20901794 295..393 100 -> Plus
chrX 20903903..20904233 394..724 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:06:01 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 1..393 115..507 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:06 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 1..393 115..507 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:45:21 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 1..393 115..507 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:37 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 1..393 115..507 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:02 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 1..393 115..507 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:06:44 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 27..750 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:06 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 27..750 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:45:21 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 32..755 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:37 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 27..750 1..724 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:02 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 32..755 1..724 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:32 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
X 21035500..21035721 1..222 100 -> Plus
X 21036399..21036470 223..294 100 -> Plus
X 21036539..21036637 295..393 100 -> Plus
X 21038746..21039076 394..724 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:32 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
X 21035500..21035721 1..222 100 -> Plus
X 21036399..21036470 223..294 100 -> Plus
X 21036539..21036637 295..393 100 -> Plus
X 21038746..21039076 394..724 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:32 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
X 21035500..21035721 1..222 100 -> Plus
X 21036399..21036470 223..294 100 -> Plus
X 21036539..21036637 295..393 100 -> Plus
X 21038746..21039076 394..724 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:45:21 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20907566..20907664 295..393 100 -> Plus
arm_X 20906527..20906748 1..222 100 -> Plus
arm_X 20907426..20907497 223..294 100 -> Plus
arm_X 20909773..20910103 394..724 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:17 Download gff for GM08921.complete
Subject Subject Range Query Range Percent Splice Strand
X 21020592..21020813 1..222 100 -> Plus
X 21021491..21021562 223..294 100 -> Plus
X 21021631..21021729 295..393 100 -> Plus
X 21023838..21024168 394..724 100   Plus

GM08921.hyp Sequence

Translation from 114 to 506

> GM08921.hyp
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFFLKANAGTFFVAHDIFRLNIHNSA*

GM08921.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-PE 130 CG1740-PE 1..130 1..130 680 100 Plus
Ntf-2-PA 130 CG1740-PA 1..130 1..130 680 100 Plus
Ntf-2r-PA 130 CG10174-PA 1..130 1..130 594 87.7 Plus
Ntf-2-PB 129 CG1740-PB 1..128 1..128 591 88.3 Plus
Ntf-2-PC 89 CG1740-PC 1..89 42..130 462 100 Plus

GM08921.pep Sequence

Translation from 114 to 506

> GM08921.pep
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFFLKANAGTFFVAHDIFRLNIHNSA*

GM08921.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21708-PA 165 GF21708-PA 1..165 1..130 630 77.6 Plus
Dana\GF23973-PA 132 GF23973-PA 1..131 1..129 424 59.5 Plus
Dana\GF20049-PA 126 GF20049-PA 1..125 1..126 336 50 Plus
Dana\GF17607-PA 692 GF17607-PA 7..128 1..123 171 32.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Ntf-2-PA 165 GG19703-PA 1..165 1..130 624 77 Plus
Dere\GG19770-PA 686 GG19770-PA 7..128 1..123 158 31.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16820-PA 130 GH16820-PA 1..130 1..130 645 90 Plus
Dgri\GH12206-PA 165 GH12206-PA 1..165 1..130 608 74.5 Plus
Dgri\GH18527-PA 675 GH18527-PA 7..128 1..123 168 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-PE 130 CG1740-PE 1..130 1..130 680 100 Plus
Ntf-2-PA 130 CG1740-PA 1..130 1..130 680 100 Plus
Ntf-2r-PA 130 CG10174-PA 1..130 1..130 594 87.7 Plus
Ntf-2-PB 129 CG1740-PB 1..128 1..128 591 88.3 Plus
Ntf-2-PC 89 CG1740-PC 1..89 42..130 462 100 Plus
rin-PG 690 CG9412-PG 8..128 2..123 173 32.5 Plus
rin-PF 690 CG9412-PF 8..128 2..123 173 32.5 Plus
rin-PE 690 CG9412-PE 8..128 2..123 173 32.5 Plus
rin-PB 690 CG9412-PB 8..128 2..123 173 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15738-PA 130 GI15738-PA 1..130 1..130 665 95.4 Plus
Dmoj\GI22064-PA 651 GI22064-PA 7..128 1..123 170 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16396-PA 165 GL16396-PA 1..165 1..130 607 73.9 Plus
Dper\GL18713-PA 157 GL18713-PA 41..152 14..125 361 58.9 Plus
Dper\GL23542-PA 697 GL23542-PA 7..128 1..123 165 32.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14503-PA 165 GA14503-PA 1..165 1..130 605 73.3 Plus
Dpse\GA25766-PA 130 GA25766-PA 1..125 1..125 387 56.8 Plus
Dpse\GA27297-PA 696 GA27297-PA 7..128 1..123 165 32.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23057-PA 130 GM23057-PA 1..130 1..130 670 97.7 Plus
Dsec\Ntf-2r-PA 130 GM17275-PA 1..130 1..130 600 86.2 Plus
Dsec\GM24117-PA 682 GM24117-PA 7..128 1..123 170 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Ntf-2-PA 165 GD17509-PA 1..165 1..130 636 78.2 Plus
Dsim\Ntf-2r-PA 130 GD24139-PA 1..130 1..130 615 87.7 Plus
Dsim\GD18916-PA 669 GD18916-PA 7..128 1..123 170 32.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18599-PA 130 GJ18599-PA 1..130 1..130 670 96.2 Plus
Dvir\GJ24112-PA 651 GJ24112-PA 8..128 2..123 171 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25032-PA 129 GK25032-PA 1..129 1..129 664 96.1 Plus
Dwil\GK13947-PA 715 GK13947-PA 7..128 1..123 167 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Ntf-2-PA 165 GE17902-PA 1..165 1..130 630 77.6 Plus
Dyak\GE26283-PA 684 GE26283-PA 7..128 1..123 169 32.3 Plus