Clone GM09283 Report

Search the DGRC for GM09283

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:92
Well:83
Vector:pBS SK-
Associated Gene/TranscriptCG14715-RA
Protein status:GM09283.pep: gold
Preliminary Size:785
Sequenced Size:598

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14715 2001-01-01 Release 2 assignment
CG14715 2002-04-09 Blastp of sequenced clone
CG14715 2003-01-01 Sim4 clustering to Release 3
CG14715 2008-04-29 Release 5.5 accounting
CG14715 2008-08-15 Release 5.9 accounting
CG14715 2008-12-18 5.12 accounting

Clone Sequence Records

GM09283.complete Sequence

598 bp (598 high quality bases) assembled on 2002-04-09

GenBank Submission: AY095183

> GM09283.complete
ATGAAGTTAACTTATATTTTGTTAATCTGCGCTTTTGTGGCCGCCTCCGC
TGCCAGCGATCCGAAAGTGAAGATTGGCATTAAGAAGCGGGTGGAGAACT
GCACCCGGAAGGCCAAGGGCGGCGATCTCGTCCACGTGCACTACAGAGGA
GCACTGCAGGATGGAACAGAGTTCGATAGCAGCTACTCCCGCGGCACTCC
CTTCTCCTTTACCCTGGGAGCTCGGCAGGTGATCAAGGGCTGGGATCAGG
GAATCCTTGGTATGTGTGAGGGTGAGCAGCGAAAGCTGACGATTCCGCCT
GAGCTGGGATACGGAGCCAGTGGAGCGGGTGGCGGAAAGATTCCCCCCAA
TGCGGTGCTCGTCTTCGATACGGAGTTGGTAAAAATCGAACCGCGCTCTG
GATCTGAAGAGCTGTAAAGCGAATAGGGCCACAAATAGGCATTCCATGCT
ACACCCAAAGTTTACTTTCAACTAAAGTCATAAACATTTAATGCTCAAAT
ATTTAAAGTAGTAATTTGTCTTGTTTCTGAAGTGATGCCACGCCACGACC
AATAAATAATAATGTCATTCCTTTTATACTAAAAAAAAAAAAAAAAAA

GM09283.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG14715-RA 739 CG14715-RA 99..679 1..581 2905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7500025..7500457 148..580 2165 100 Plus
chr3R 27901430 chr3R 7499815..7499962 1..148 740 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:20:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11674492..11674925 148..581 2170 100 Plus
3R 32079331 3R 11674282..11674429 1..148 740 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11415323..11415756 148..581 2170 100 Plus
3R 31820162 3R 11415113..11415260 1..148 740 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:37:10 has no hits.

GM09283.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:38:20 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7499815..7499961 1..147 100 -> Plus
chr3R 7500025..7500457 148..580 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:06:14 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 1..417 1..417 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:47 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 1..417 1..417 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:33:14 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 1..417 1..417 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:15 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 1..417 1..417 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:55 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 1..417 1..417 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:06:13 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 64..643 1..580 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:47 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 64..642 1..579 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:33:14 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 62..640 1..579 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:15 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 64..643 1..580 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:55 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14715-RA 62..640 1..579 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:20 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11674282..11674428 1..147 100 -> Plus
3R 11674492..11674924 148..580 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:20 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11674282..11674428 1..147 100 -> Plus
3R 11674492..11674924 148..580 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:20 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11674282..11674428 1..147 100 -> Plus
3R 11674492..11674924 148..580 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:33:14 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7500004..7500150 1..147 100 -> Plus
arm_3R 7500214..7500646 148..580 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:53 Download gff for GM09283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11415323..11415755 148..580 100   Plus
3R 11415113..11415259 1..147 100 -> Plus

GM09283.pep Sequence

Translation from 0 to 416

> GM09283.pep
MKLTYILLICAFVAASAASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRG
ALQDGTEFDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPP
ELGYGASGAGGGKIPPNAVLVFDTELVKIEPRSGSEEL*

GM09283.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18389-PA 137 GF18389-PA 1..137 1..138 564 81.9 Plus
Dana\GF12094-PA 214 GF12094-PA 1..130 1..129 345 52.7 Plus
Dana\GF11585-PA 108 GF11585-PA 18..108 39..130 239 50 Plus
Dana\GF14673-PA 440 GF14673-PA 27..118 35..127 210 47.3 Plus
Dana\GF23032-PA 358 GF23032-PA 266..358 37..130 186 47.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18343-PA 138 GG18343-PA 1..138 1..138 715 97.8 Plus
Dere\GG20775-PA 231 GG20775-PA 16..147 1..129 341 51.1 Plus
Dere\GG21957-PA 108 GG21957-PA 18..108 39..130 239 50 Plus
Dere\GG20671-PA 355 GG20671-PA 239..351 16..126 211 44.7 Plus
Dere\GG10059-PA 439 GG10059-PA 26..117 35..127 204 47.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18265-PA 138 GH18265-PA 1..138 1..138 524 77 Plus
Dgri\GH20056-PA 212 GH20056-PA 2..128 3..129 339 53.1 Plus
Dgri\GH23096-PA 108 GH23096-PA 18..108 39..130 239 50 Plus
Dgri\GH11297-PA 441 GH11297-PA 36..118 44..127 195 47.6 Plus
Dgri\GH21813-PA 365 GH21813-PA 273..365 37..130 177 45.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG14715-PA 138 CG14715-PA 1..138 1..138 717 100 Plus
Fkbp14-PF 216 CG9847-PF 11..132 8..129 324 52.8 Plus
Fkbp14-PE 216 CG9847-PE 11..132 8..129 324 52.8 Plus
Fkbp14-PC 216 CG9847-PC 11..132 8..129 324 52.8 Plus
Fkbp14-PA 216 CG9847-PA 11..132 8..129 324 52.8 Plus
Fkbp14-PD 220 CG9847-PD 11..132 8..129 324 52.8 Plus
Fkbp12-PA 108 CG11001-PA 18..108 39..130 243 50 Plus
Fkbp39-PA 357 CG6226-PA 242..353 17..126 216 45.1 Plus
Fkbp59-PB 439 CG4535-PB 26..117 35..127 203 47.3 Plus
Fkbp59-PA 439 CG4535-PA 26..117 35..127 203 47.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24072-PA 139 GI24072-PA 1..139 1..138 536 78.4 Plus
Dmoj\GI20465-PA 424 GI20465-PA 214..340 3..129 353 54.7 Plus
Dmoj\GI18922-PA 108 GI18922-PA 18..108 39..130 239 50 Plus
Dmoj\GI21928-PA 370 GI21928-PA 278..366 37..126 196 46.7 Plus
Dmoj\GI17716-PA 441 GI17716-PA 36..118 44..127 195 47.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22120-PA 139 GL22120-PA 1..139 1..138 544 81.3 Plus
Dper\GL17491-PA 214 GL17491-PA 24..130 23..129 331 58.3 Plus
Dper\GL17641-PA 108 GL17641-PA 18..108 39..130 237 50 Plus
Dper\GL18937-PA 440 GL18937-PA 33..118 41..127 197 47.1 Plus
Dper\GL24296-PA 342 GL24296-PA 250..338 37..126 185 44.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13197-PA 139 GA13197-PA 1..139 1..138 544 81.3 Plus
Dpse\GA22070-PA 214 GA22070-PA 24..130 23..129 331 58.3 Plus
Dpse\GA10702-PA 108 GA10702-PA 18..108 39..130 237 50 Plus
Dpse\GA18239-PA 440 GA18239-PA 33..118 41..127 196 47.1 Plus
Dpse\GA26561-PA 341 GA26561-PA 249..337 37..126 185 44.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23968-PA 138 GM23968-PA 1..138 1..138 713 97.8 Plus
Dsec\GM15719-PA 231 GM15719-PA 21..147 3..129 341 51.6 Plus
Dsec\GM21945-PA 108 GM21945-PA 18..108 39..130 239 50 Plus
Dsec\GM25784-PA 349 GM25784-PA 234..345 17..126 207 44.2 Plus
Dsec\GM17712-PA 439 GM17712-PA 26..117 35..127 202 46.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18774-PA 138 GD18774-PA 1..138 1..138 720 98.6 Plus
Dsim\GD25197-PA 231 GD25197-PA 21..147 3..129 342 51.6 Plus
Dsim\GD23632-PA 402 GD23632-PA 26..117 35..127 201 46.2 Plus
Dsim\GD20361-PA 348 GD20361-PA 233..344 17..126 200 44.2 Plus
Dsim\GD11442-PA 137 GD11442-PA 18..85 39..106 181 48.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10892-PA 138 GJ10892-PA 1..138 1..138 547 82 Plus
Dvir\GJ22316-PA 212 GJ22316-PA 2..128 3..129 351 53.9 Plus
Dvir\GJ19778-PA 108 GJ19778-PA 18..108 39..130 243 51.1 Plus
Dvir\GJ17544-PA 441 GJ17544-PA 36..118 44..127 195 47.6 Plus
Dvir\GJ14288-PA 359 GJ14288-PA 267..355 37..126 164 45.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22382-PA 139 GK22382-PA 1..139 1..138 514 80 Plus
Dwil\GK20742-PA 211 GK20742-PA 1..127 1..129 341 53.1 Plus
Dwil\GK20673-PA 108 GK20673-PA 18..108 39..130 239 50 Plus
Dwil\GK23813-PA 440 GK23813-PA 27..118 35..127 206 46.2 Plus
Dwil\GK11959-PA 358 GK11959-PA 265..357 36..129 185 46.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24193-PA 138 GE24193-PA 1..138 1..138 711 97.8 Plus
Dyak\Fkbp13-PA 231 GE13712-PA 21..147 3..129 343 51.6 Plus
Dyak\FK506-bp2-PA 108 GE12036-PA 18..108 39..130 239 50 Plus
Dyak\GE26389-PA 353 GE26389-PA 238..349 17..126 206 44.2 Plus
Dyak\FKBP59-PA 439 GE18873-PA 26..117 35..127 205 47.3 Plus

GM09283.hyp Sequence

Translation from 1 to 416

> GM09283.hyp
MKLTYILLICAFVAASAASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRG
ALQDGTEFDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPP
ELGYGASGAGGGKIPPNAVLVFDTELVKIEPRSGSEEL*

GM09283.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14715-PA 138 CG14715-PA 1..138 1..138 717 100 Plus
Fkbp14-PF 216 CG9847-PF 11..132 8..129 324 52.8 Plus
Fkbp14-PE 216 CG9847-PE 11..132 8..129 324 52.8 Plus
Fkbp14-PC 216 CG9847-PC 11..132 8..129 324 52.8 Plus
Fkbp14-PA 216 CG9847-PA 11..132 8..129 324 52.8 Plus