Clone GM10231 Report

Search the DGRC for GM10231

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:102
Well:31
Vector:pBS SK-
Associated Gene/TranscriptCG8281-RA
Protein status:GM10231.pep: gold
Sequenced Size:1319

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8281 2002-12-10 Blastp of sequenced clone
CG8281 2003-01-01 Sim4 clustering to Release 3
CG8281 2008-04-29 Release 5.5 accounting
CG8281 2008-08-15 Release 5.9 accounting
CG8281 2008-12-18 5.12 accounting

Clone Sequence Records

GM10231.complete Sequence

1319 bp (1319 high quality bases) assembled on 2002-12-10

GenBank Submission: BT003284

> GM10231.complete
TCAAACGCGCAATTACAACAAACACAGTTCGTTCGCATTGACAGTTGGTC
AATAGGTCCATACAGGATTCGCTGAAGTGGTGAAGATAGCCAAGGACTGC
AGCTGGCGAGGATTGGCAGAGGGTAATCCAGAGATCCGCGCAAAATGCTG
CCACAAACGCCGCCGCACGGATTGAAGGTGATGTCGGGAGCGGAGGAGAA
CCGACACTATCTGCGCGCCTTCATCCAGACATACAGGGATCTGCCCGTGC
TGTGGGACACATCGCTGCGGGACTACACCAATCGGGAGAAGCGGGCGGAG
GCCTATCTGCGCCTGGTGCCCATATACCATTATCTCAAGCGGGACGCCAC
CGTGGAGGATGTGAAAAAGAAGATCAACACACTGCGCACGAACTACCGCA
AGGAGCTAAAGGTGGTGGAGAGTGCCCTGCGATCGGGCAGCCTCCACAGT
CCACGCTGCTGGACCTTTCAGGAGCTGGACTTTCTGCGCAACTCGGAGAA
GTTTCTAGCCGTCAATCCCGCCTTTAAGAACGAGCCCAACTTCGCCTTCG
GTGAGAGCAGCAATTGCCCGAGTGCGTTTCTGGAGAGCCAGGGAGCAGCC
CTCCATTATCCAGCACCACGCGCTGGTGGTCAGACGCCCAACATTTCCGA
GATGTTTCACAAATCATTTGGAGCTCCGCCACCGCCACCGCCAGCAACCA
ACCATGTGGATTATGGGAGCAGCAAGCGAGCCAGGCAAACACCGCCATGT
ACGGGAGCAGGAGCCGGATCTACTGGCGGTCCAGGTGCAACAGGCACCGC
CCACAACACCGACGAACTACTCAACATAGCCTGCGAGTATTTGGCTGGCA
CATATCCGGAGGAGGAGTCCATCGCCCGCACCTGGACGCACAAACTGAAG
CGACTGCCGCGCGAGCAGCGTCTTCTGGCCGAACGCTTCATCAACGAGAT
TCTCTTCGAGGCCGAGTCCAACAATCTGCATCGCGGATCTGTGCAAATCA
ACAACAGCTTCGAACCCTACGTTCGCTACGAAGAAACGCCAAATGGTCAC
GAGGAGCAGGACAAATCACAGAGCCCCAGCGTGCACACCTCCAGCGAATC
CAAGCCCAATGTGTCGGGAGCGAGCGGAAGCGGGGGAGGAGGTGGGCCAC
CGGGCAGCACCACCACCAGTGCGGGCATCAGGGAGTTCTAAGTTTAGTTT
AGTTACTAAGTGTTAAGTTTTTATTGGCCGAGGGATAAATGGCAAATGCG
ATCAAATTGGCTCAACAATGAAAATCAACAATAAATAAACCTGTAAATAA
TAAAAAAAAAAAAAAAAAA

GM10231.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG8281-RA 1294 CG8281-RA 1..1294 1..1294 6305 99.1 Plus
CG8111.a 1364 CG8111.a 1260..1364 1302..1198 510 99 Minus
CG8111-RA 1435 CG8111-RA 1331..1435 1302..1198 510 99 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7904580..7905880 1..1301 6340 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:21:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7912463..7913764 1..1302 6345 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7905563..7906864 1..1302 6345 99.1 Plus
Blast to na_te.dros performed on 2019-03-16 03:33:01 has no hits.

GM10231.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:34:03 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7904580..7905880 1..1301 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:06:42 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1047 145..1191 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:02:17 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1047 145..1191 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:26 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1047 145..1191 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:52:39 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1047 145..1191 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:08:20 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1047 145..1191 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:20:21 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1191 1..1191 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:02:17 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1301 1..1301 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:26 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1301 1..1301 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:52:39 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1191 1..1191 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:08:20 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
CG8281-RA 1..1301 1..1301 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:03 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7912463..7913763 1..1301 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:03 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7912463..7913763 1..1301 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:03 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7912463..7913763 1..1301 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:26 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7905563..7906863 1..1301 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:24:41 Download gff for GM10231.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7905563..7906863 1..1301 99   Plus

GM10231.hyp Sequence

Translation from 144 to 1190

> GM10231.hyp
MLPQTPPHGLKVMSGAEENRHYLRAFIQTYRDLPVLWDTSLRDYTNREKR
AEAYLRLVPIYHYLKRDATVEDVKKKINTLRTNYRKELKVVESALRSGSL
HSPRCWTFQELDFLRNSEKFLAVNPAFKNEPNFAFGESSNCPSAFLESQG
AALHYPAPRAGGQTPNISEMFHKSFGAPPPPPPATNHVDYGSSKRARQTP
PCTGAGAGSTGGPGATGTAHNTDELLNIACEYLAGTYPEEESIARTWTHK
LKRLPREQRLLAERFINEILFEAESNNLHRGSVQINNSFEPYVRYEETPN
GHEEQDKSQSPSVHTSSESKPNVSGASGSGGGGGPPGSTTTSAGIREF*

GM10231.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG8281-PA 348 CG8281-PA 1..348 1..348 1856 100 Plus
CG4004-PE 319 CG4004-PE 16..105 23..115 166 34.4 Plus
CG4004-PD 319 CG4004-PD 16..105 23..115 166 34.4 Plus
CG4004-PA 319 CG4004-PA 16..105 23..115 166 34.4 Plus
CG4004-PB 339 CG4004-PB 1..83 33..118 153 38.4 Plus

GM10231.pep Sequence

Translation from 144 to 1190

> GM10231.pep
MLPQTPPHGLKVMSGAEENRHYLRAFIQTYRDLPVLWDTSLRDYTNREKR
AEAYLRLVPIYHYLKRDATVEDVKKKINTLRTNYRKELKVVESALRSGSL
HSPRCWTFQELDFLRNSEKFLAVNPAFKNEPNFAFGESSNCPSAFLESQG
AALHYPAPRAGGQTPNISEMFHKSFGAPPPPPPATNHVDYGSSKRARQTP
PCTGAGAGSTGGPGATGTAHNTDELLNIACEYLAGTYPEEESIARTWTHK
LKRLPREQRLLAERFINEILFEAESNNLHRGSVQINNSFEPYVRYEETPN
GHEEQDKSQSPSVHTSSESKPNVSGASGSGGGGGPPGSTTTSAGIREF*

GM10231.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23799-PA 335 GF23799-PA 1..333 1..329 1350 82.8 Plus
Dana\GF21386-PA 511 GF21386-PA 47..141 18..115 188 38.8 Plus
Dana\GF21386-PA 511 GF21386-PA 175..264 22..114 181 37.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14454-PA 342 GG14454-PA 1..323 1..323 1573 96.3 Plus
Dere\GG17737-PA 534 GG17737-PA 16..105 23..115 174 37.6 Plus
Dere\GG14648-PA 288 GG14648-PA 14..288 20..289 166 27.1 Plus
Dere\GG17737-PA 534 GG17737-PA 187..276 22..114 164 35.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14980-PA 373 GH14980-PA 1..373 1..348 1298 68.5 Plus
Dgri\GH16042-PA 308 GH16042-PA 13..303 20..288 183 24.3 Plus
Dgri\GH12132-PA 183 GH12132-PA 9..103 18..115 176 34.7 Plus
Dgri\GH12134-PA 398 GH12134-PA 8..111 19..118 174 38.5 Plus
Dgri\GH17048-PA 212 GH17048-PA 13..106 26..115 151 35.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8281-PA 348 CG8281-PA 1..348 1..348 1856 100 Plus
CG4004-PE 319 CG4004-PE 16..105 23..115 166 34.4 Plus
CG4004-PD 319 CG4004-PD 16..105 23..115 166 34.4 Plus
CG4004-PA 319 CG4004-PA 16..105 23..115 166 34.4 Plus
CG4004-PB 339 CG4004-PB 1..83 33..118 153 38.4 Plus
CG3163-PA 368 CG3163-PA 3..159 22..198 152 25.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13142-PA 361 GI13142-PA 16..361 10..348 1202 70.9 Plus
Dmoj\GI15912-PA 455 GI15912-PA 8..102 18..115 194 36.7 Plus
Dmoj\GI12053-PA 234 GI12053-PA 13..101 26..114 174 38.2 Plus
Dmoj\GI12306-PA 295 GI12306-PA 13..281 20..278 171 26.6 Plus
Dmoj\GI20699-PA 360 GI20699-PA 3..102 22..118 156 35 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18043-PA 346 GL18043-PA 1..309 1..320 908 63.5 Plus
Dper\GL13143-PA 543 GL13143-PA 40..134 18..115 199 39.8 Plus
Dper\GL13143-PA 543 GL13143-PA 187..276 22..114 171 38.7 Plus
Dper\GL20840-PA 298 GL20840-PA 14..284 20..279 171 25.1 Plus
Dper\GL20841-PA 792 GL20841-PA 508..777 20..278 168 25.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20952-PA 363 GA20952-PA 1..326 1..320 1243 76.9 Plus
Dpse\GA17842-PA 543 GA17842-PA 40..134 18..115 197 39.8 Plus
Dpse\GA17842-PA 543 GA17842-PA 187..276 22..114 170 38.7 Plus
Dpse\GA17418-PA 298 GA17418-PA 14..284 20..279 170 25.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25005-PA 348 GM25005-PA 1..348 1..348 1826 98 Plus
Dsec\GM11582-PA 468 GM11582-PA 130..218 23..114 169 38 Plus
Dsec\GM11582-PA 468 GM11582-PA 16..105 23..115 160 34.4 Plus
Dsec\GM14263-PA 288 GM14263-PA 14..117 20..120 149 36.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14040-PA 245 GD14040-PA 1..245 105..348 1236 96.3 Plus
Dsim\GD14039-PA 72 GD14039-PA 1..71 1..71 377 98.6 Plus
Dsim\GD24799-PA 148 GD24799-PA 16..105 23..115 165 34.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13890-PA 346 GJ13890-PA 1..346 1..348 1280 74.6 Plus
Dvir\GJ13325-PA 258 GJ13325-PA 1..258 13..287 204 27.8 Plus
Dvir\GJ16819-PA 495 GJ16819-PA 8..102 18..115 193 36.7 Plus
Dvir\GJ13242-PA 295 GJ13242-PA 13..281 20..279 163 24.1 Plus
Dvir\GJ20438-PA 358 GJ20438-PA 3..102 22..118 151 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18054-PA 379 GK18054-PA 10..348 3..324 1215 71.2 Plus
Dwil\GK16686-PA 366 GK16686-PA 16..113 20..114 159 35.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21643-PA 342 GE21643-PA 1..342 1..348 1569 93.4 Plus
Dyak\GE17027-PA 498 GE17027-PA 16..105 23..115 172 38.7 Plus
Dyak\GE17027-PA 498 GE17027-PA 130..218 23..114 169 37 Plus
Dyak\GE21008-PA 288 GE21008-PA 14..117 20..120 149 36.2 Plus