Clone GM12126 Report

Search the DGRC for GM12126

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:121
Well:26
Vector:pOT2
Associated Gene/TranscriptCG7006-RA
Protein status:GM12126.pep: gold
Preliminary Size:821
Sequenced Size:689

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7006 2001-01-01 Release 2 assignment
CG7006 2002-01-03 Blastp of sequenced clone
CG7006 2003-01-01 Sim4 clustering to Release 3
CG7006 2008-04-29 Release 5.5 accounting
CG7006 2008-08-15 Release 5.9 accounting
CG7006 2008-12-18 5.12 accounting

Clone Sequence Records

GM12126.complete Sequence

689 bp (689 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075367

> GM12126.complete
TTGAGCAGTTTGTTTTCCTCTTTTTTCCGCTTAATTTAACTTAAAATGAA
ACGCCTGAGCGACGAACGTGCCAAGATCTTGTTCGAGCACCTGTCCAAAT
ACATTGGCACAAATGTGAAGCATTTGATTGACCGGCCAGATGGAACATAT
TGCTTTCGGGAGCACAAGGATCGGGTCTACTACGTCTCGGAGCGGATTTT
GAAGCTGAGCGAGTGCTTCGGCTACAAGCAGCTGGTGTGCGTGGGCACCT
GCTTCGGCAAGTTCTCCAAGACCAACAAACTGAAGTTCCATATCACGGCG
CTCTACTACTTGGCGCCCTACGCCCAGTACAAGGTGTGGGTGAAGCCCTC
CTTCGAGCAGCAGTTTCTCTACGGCAACCACATACCCAAAACCGGACTGG
GTCGCATCACGGAGAACGCCGGCCAGTACCAGGGCGTGGTGGTTTACTCC
ATGAACGACCTGCCTCTGGGCTTCGGCGTCCTGGCGCGTTCCACAACGGA
CTGCAAGACCGCCGATCCCATGACCACCGTATGCTTTCATCAGTCGGATA
TCGGCGAATATATTCGCGCCGAGGACACGCTCTTTTAGATCCATAGATGC
TAAGTTTTTACATGTTTTGTAGCAATAACCATGTTTAGGTAAATAATAAG
TATGCTGAAAAACGGAAAAAAAAAAAAAAAAAAAAAAAA

GM12126.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:34:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG7006-RA 828 CG7006-RA 79..748 1..670 3275 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20674008..20674571 102..665 2760 99.3 Plus
chr3R 27901430 chr3R 20673856..20673956 1..101 505 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:21:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24850822..24851390 102..670 2770 99.1 Plus
3R 32079331 3R 24850670..24850770 1..101 505 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24591653..24592221 102..670 2770 99.1 Plus
3R 31820162 3R 24591501..24591601 1..101 505 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:35:12 has no hits.

GM12126.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:35:54 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20673856..20673956 1..101 100 -> Plus
chr3R 20674008..20674571 102..665 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:07:03 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 1..543 46..588 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:56:39 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 1..543 46..588 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:33:38 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 1..543 46..588 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:21:28 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 1..543 46..588 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:10:39 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 1..543 46..588 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:20:56 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 39..703 1..665 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:56:38 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 52..716 1..665 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:33:38 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 44..708 1..665 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:21:29 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 39..703 1..665 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:10:39 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
CG7006-RA 44..708 1..665 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:54 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24850670..24850770 1..101 100 -> Plus
3R 24850822..24851385 102..665 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:54 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24850670..24850770 1..101 100 -> Plus
3R 24850822..24851385 102..665 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:54 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24850670..24850770 1..101 100 -> Plus
3R 24850822..24851385 102..665 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:33:38 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20676392..20676492 1..101 100 -> Plus
arm_3R 20676544..20677107 102..665 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:56:14 Download gff for GM12126.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24591653..24592216 102..665 99   Plus
3R 24591501..24591601 1..101 100 -> Plus

GM12126.hyp Sequence

Translation from 45 to 587

> GM12126.hyp
MKRLSDERAKILFEHLSKYIGTNVKHLIDRPDGTYCFREHKDRVYYVSER
ILKLSECFGYKQLVCVGTCFGKFSKTNKLKFHITALYYLAPYAQYKVWVK
PSFEQQFLYGNHIPKTGLGRITENAGQYQGVVVYSMNDLPLGFGVLARST
TDCKTADPMTTVCFHQSDIGEYIRAEDTLF*

GM12126.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG7006-PA 180 CG7006-PA 1..180 1..180 970 100 Plus

GM12126.pep Sequence

Translation from 45 to 587

> GM12126.pep
MKRLSDERAKILFEHLSKYIGTNVKHLIDRPDGTYCFREHKDRVYYVSER
ILKLSECFGYKQLVCVGTCFGKFSKTNKLKFHITALYYLAPYAQYKVWVK
PSFEQQFLYGNHIPKTGLGRITENAGQYQGVVVYSMNDLPLGFGVLARST
TDCKTADPMTTVCFHQSDIGEYIRAEDTLF*

GM12126.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16996-PA 180 GF16996-PA 1..180 1..180 947 97.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11326-PA 180 GG11326-PA 1..180 1..180 964 99.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19597-PA 180 GH19597-PA 1..180 1..180 898 89.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG7006-PA 180 CG7006-PA 1..180 1..180 970 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23991-PA 180 GI23991-PA 1..180 1..180 923 93.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13936-PA 180 GL13936-PA 1..180 1..180 870 88.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20024-PA 180 GA20024-PA 1..180 1..180 870 88.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26634-PA 180 GM26634-PA 1..180 1..180 966 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21137-PA 180 GD21137-PA 1..180 1..180 966 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23588-PA 180 GJ23588-PA 1..180 1..180 904 91.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22489-PA 180 GK22489-PA 1..180 1..180 936 95.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23522-PA 180 GE23522-PA 1..180 1..180 964 99.4 Plus