BDGP Sequence Production Resources |
Search the DGRC for GM12126
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 121 |
Well: | 26 |
Vector: | pOT2 |
Associated Gene/Transcript | CG7006-RA |
Protein status: | GM12126.pep: gold |
Preliminary Size: | 821 |
Sequenced Size: | 689 |
Gene | Date | Evidence |
---|---|---|
CG7006 | 2001-01-01 | Release 2 assignment |
CG7006 | 2002-01-03 | Blastp of sequenced clone |
CG7006 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7006 | 2008-04-29 | Release 5.5 accounting |
CG7006 | 2008-08-15 | Release 5.9 accounting |
CG7006 | 2008-12-18 | 5.12 accounting |
689 bp (689 high quality bases) assembled on 2002-01-03
GenBank Submission: AY075367
> GM12126.complete TTGAGCAGTTTGTTTTCCTCTTTTTTCCGCTTAATTTAACTTAAAATGAA ACGCCTGAGCGACGAACGTGCCAAGATCTTGTTCGAGCACCTGTCCAAAT ACATTGGCACAAATGTGAAGCATTTGATTGACCGGCCAGATGGAACATAT TGCTTTCGGGAGCACAAGGATCGGGTCTACTACGTCTCGGAGCGGATTTT GAAGCTGAGCGAGTGCTTCGGCTACAAGCAGCTGGTGTGCGTGGGCACCT GCTTCGGCAAGTTCTCCAAGACCAACAAACTGAAGTTCCATATCACGGCG CTCTACTACTTGGCGCCCTACGCCCAGTACAAGGTGTGGGTGAAGCCCTC CTTCGAGCAGCAGTTTCTCTACGGCAACCACATACCCAAAACCGGACTGG GTCGCATCACGGAGAACGCCGGCCAGTACCAGGGCGTGGTGGTTTACTCC ATGAACGACCTGCCTCTGGGCTTCGGCGTCCTGGCGCGTTCCACAACGGA CTGCAAGACCGCCGATCCCATGACCACCGTATGCTTTCATCAGTCGGATA TCGGCGAATATATTCGCGCCGAGGACACGCTCTTTTAGATCCATAGATGC TAAGTTTTTACATGTTTTGTAGCAATAACCATGTTTAGGTAAATAATAAG TATGCTGAAAAACGGAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7006-RA | 828 | CG7006-RA | 79..748 | 1..670 | 3275 | 99.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 20673856..20673956 | 1..101 | 100 | -> | Plus |
chr3R | 20674008..20674571 | 102..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 1..543 | 46..588 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 1..543 | 46..588 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 1..543 | 46..588 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 1..543 | 46..588 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 1..543 | 46..588 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 39..703 | 1..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 52..716 | 1..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 44..708 | 1..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 39..703 | 1..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7006-RA | 44..708 | 1..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24850670..24850770 | 1..101 | 100 | -> | Plus |
3R | 24850822..24851385 | 102..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24850670..24850770 | 1..101 | 100 | -> | Plus |
3R | 24850822..24851385 | 102..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24850670..24850770 | 1..101 | 100 | -> | Plus |
3R | 24850822..24851385 | 102..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 20676392..20676492 | 1..101 | 100 | -> | Plus |
arm_3R | 20676544..20677107 | 102..665 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24591653..24592216 | 102..665 | 99 | Plus | |
3R | 24591501..24591601 | 1..101 | 100 | -> | Plus |
Translation from 45 to 587
> GM12126.hyp MKRLSDERAKILFEHLSKYIGTNVKHLIDRPDGTYCFREHKDRVYYVSER ILKLSECFGYKQLVCVGTCFGKFSKTNKLKFHITALYYLAPYAQYKVWVK PSFEQQFLYGNHIPKTGLGRITENAGQYQGVVVYSMNDLPLGFGVLARST TDCKTADPMTTVCFHQSDIGEYIRAEDTLF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7006-PA | 180 | CG7006-PA | 1..180 | 1..180 | 970 | 100 | Plus |
Translation from 45 to 587
> GM12126.pep MKRLSDERAKILFEHLSKYIGTNVKHLIDRPDGTYCFREHKDRVYYVSER ILKLSECFGYKQLVCVGTCFGKFSKTNKLKFHITALYYLAPYAQYKVWVK PSFEQQFLYGNHIPKTGLGRITENAGQYQGVVVYSMNDLPLGFGVLARST TDCKTADPMTTVCFHQSDIGEYIRAEDTLF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16996-PA | 180 | GF16996-PA | 1..180 | 1..180 | 947 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11326-PA | 180 | GG11326-PA | 1..180 | 1..180 | 964 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19597-PA | 180 | GH19597-PA | 1..180 | 1..180 | 898 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7006-PA | 180 | CG7006-PA | 1..180 | 1..180 | 970 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23991-PA | 180 | GI23991-PA | 1..180 | 1..180 | 923 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13936-PA | 180 | GL13936-PA | 1..180 | 1..180 | 870 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20024-PA | 180 | GA20024-PA | 1..180 | 1..180 | 870 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26634-PA | 180 | GM26634-PA | 1..180 | 1..180 | 966 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21137-PA | 180 | GD21137-PA | 1..180 | 1..180 | 966 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23588-PA | 180 | GJ23588-PA | 1..180 | 1..180 | 904 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22489-PA | 180 | GK22489-PA | 1..180 | 1..180 | 936 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23522-PA | 180 | GE23522-PA | 1..180 | 1..180 | 964 | 99.4 | Plus |