Clone GM12243 Report

Search the DGRC for GM12243

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:122
Well:43
Vector:pOT2
Associated Gene/TranscriptCG44325-RB
Protein status:GM12243.pep: gold
Sequenced Size:749

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7267 2008-06-05 Manual selection by Joe Carlson
CG7267-RB 2009-01-21 est gleaning

Clone Sequence Records

GM12243.complete Sequence

749 bp assembled on 2009-04-22

GenBank Submission: BT082058.1

> GM12243.complete
TGGCATCAACACGCACCAGCAAAATCAAGCGCATCCAGTCGACCCAATCC
AGTTCCATTCCATAAAAGCCAACGAAAGCGAAATCTCAACCGAGCGTCAT
GGAGTTCAACAATCGCCTCTTGCTGAAGATCATCGAGCTGGCCATCGCCA
TCGCCTGCATTGTGCTATACGAGACGGTTGGTAACTTGTCCCTCCATCCG
GTGATTGTGGCCGGCACCGTTGGTGGCTACACCGTCATCTGCGGCGTTCT
GCTGATCGGTCATGTGCTCAACTCGCTGGTGGAGAAGCGCCTGAACGCCC
TATTCTCGCTGATCGGCTGCCTGCTGTTCGTGGCCTCCGGAGCACTGGTG
ATCGATGAGTGGCACGGCGGACTCCTGAATACCGATAGGAAGCGCCAGGC
CATTGGAGCCGGTTCCTTGATGATCATCAATGCGGCTGTCTTCCTTCTGG
ACACTCTCTGCATCTGCCGGACGTAAAGATTCCGTTTCGTCGTATATGTA
CTGCATATCCGTTTATTTTTTTTTTTTCGCAAATCGAATAACTCGTGTTG
ATAAGCATAATGAAACAAGAATCTATTGTAAATGTTAACGTAACATTTGT
TTTTTTTTTTGTAGCTGTTTTATATGTATTTATACGTGTCTTAAGCTAAT
CTCAGATATGCGCACGCAGATTATATACAGGAATCCATTAAATATATACA
CATACACAACATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM12243.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG7267.a 960 CG7267.a 52..654 1..604 2935 99.3 Plus
CG7267-RB 902 CG7267-RB 275..877 1..604 2935 99.3 Plus
CG7267.a 960 CG7267.a 674..770 617..713 485 100 Plus
CG10970-RA 1810 CG10970-RA 1..68 646..713 340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8963150..8963611 712..258 2050 96.8 Minus
chrX 22417052 chrX 8970149..8970289 141..1 705 100 Minus
chrX 22417052 chrX 8963679..8963799 260..140 605 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:21:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9071341..9071802 713..258 1975 96.1 Minus
X 23542271 X 9078336..9078476 141..1 705 100 Minus
X 23542271 X 9071870..9071990 260..140 605 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9079555..9079900 604..258 1650 98.8 Minus
X 23527363 X 9086434..9086574 141..1 705 100 Minus
X 23527363 X 9079968..9080088 260..140 605 100 Minus
X 23527363 X 9079439..9079535 713..617 485 100 Minus
Blast to na_te.dros performed 2019-03-15 20:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
Circe 7450 Circe CIRC 7450bp 6989..7102 547..659 126 60.3 Plus

GM12243.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:25:05 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8970150..8970289 1..140 100   Minus
chrX 8963150..8963610 259..712 97 <- Minus
chrX 8963681..8963798 141..258 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:50 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
CG7267-RB 1..378 99..476 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:51 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
CG7267-RB 1..378 99..476 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:52:18 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
CG44325-RB 1..378 99..476 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:57 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
CG44325-RB 1..378 99..476 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-22 09:22:22 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
CG7267-RB 20..631 1..619 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:51 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
CG7267-RB 20..631 1..619 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:52:18 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
CG44325-RB 24..741 1..712 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:57 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
CG44325-RB 24..741 1..712 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:05 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
X 9078337..9078476 1..140 100   Minus
X 9071342..9071801 259..712 96 <- Minus
X 9071872..9071989 141..258 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:05 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
X 9078337..9078476 1..140 100   Minus
X 9071342..9071801 259..712 96 <- Minus
X 9071872..9071989 141..258 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:05 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
X 9078337..9078476 1..140 100   Minus
X 9071342..9071801 259..712 96 <- Minus
X 9071872..9071989 141..258 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:52:18 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8965375..8965834 259..712 96 <- Minus
arm_X 8965905..8966022 141..258 100 <- Minus
arm_X 8972370..8972509 1..140 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:30:33 Download gff for GM12243.complete
Subject Subject Range Query Range Percent Splice Strand
X 9079440..9079899 259..712 96 <- Minus
X 9079970..9080087 141..258 100 <- Minus
X 9086435..9086574 1..140 100   Minus

GM12243.pep Sequence

Translation from 98 to 475

> GM12243.pep
MEFNNRLLLKIIELAIAIACIVLYETVGNLSLHPVIVAGTVGGYTVICGV
LLIGHVLNSLVEKRLNALFSLIGCLLFVASGALVIDEWHGGLLNTDRKRQ
AIGAGSLMIINAAVFLLDTLCICRT*

GM12243.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19114-PA 125 GF19114-PA 1..125 1..125 512 81.6 Plus
Dana\GF21858-PA 131 GF21858-PA 5..129 2..124 155 32.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19007-PA 228 GG19007-PA 117..228 14..125 554 97.3 Plus
Dere\GG19007-PA 228 GG19007-PA 1..90 1..88 185 44.4 Plus
Dere\GG17559-PA 131 GG17559-PA 5..129 2..124 156 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17713-PA 235 GH17713-PA 125..235 16..125 413 75.7 Plus
Dgri\GH17713-PA 235 GH17713-PA 1..122 1..120 251 42.6 Plus
Dgri\GH12523-PA 131 GH12523-PA 5..129 2..124 158 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG44325-PE 125 CG44325-PE 1..125 1..125 627 100 Plus
CG44325-PB 125 CG44325-PB 1..125 1..125 627 100 Plus
CG44325-PD 146 CG44325-PD 1..125 1..125 627 100 Plus
CG44325-PC 127 CG44325-PC 1..116 1..114 235 39.7 Plus
CG44325-PA 146 CG44325-PA 1..135 1..114 205 34.1 Plus
CG15449-PA 131 CG15449-PA 12..125 8..120 158 32.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15457-PA 119 GI15457-PA 9..119 16..125 401 73 Plus
Dmoj\GI15456-PA 128 GI15456-PA 1..124 1..122 255 43.5 Plus
Dmoj\GI14877-PA 131 GI14877-PA 5..129 2..124 155 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13023-PA 228 GL13023-PA 125..228 22..125 415 77.9 Plus
Dper\GL13023-PA 228 GL13023-PA 1..90 1..88 214 47.8 Plus
Dper\GL16585-PA 131 GL16585-PA 5..129 2..124 156 32.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20224-PA 228 GA20224-PA 125..228 22..125 415 77.9 Plus
Dpse\GA20224-PA 228 GA20224-PA 1..90 1..88 214 47.8 Plus
Dpse\GA13737-PA 131 GA13737-PA 5..129 2..124 156 32.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13685-PA 247 GM13685-PA 136..247 14..125 561 99.1 Plus
Dsec\GM13685-PA 247 GM13685-PA 1..133 1..112 178 33.8 Plus
Dsec\GM22643-PA 121 GM22643-PA 10..119 16..124 138 31.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16087-PA 125 GD16087-PA 1..125 1..125 623 100 Plus
Dsim\GD15513-PA 131 GD15513-PA 5..129 2..124 155 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19171-PA 126 GJ19171-PA 1..126 1..125 481 77.8 Plus
Dvir\GJ19540-PA 131 GJ19540-PA 12..129 8..124 159 32.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16752-PA 206 GK16752-PA 96..206 15..125 442 79.3 Plus
Dwil\GK16752-PA 206 GK16752-PA 1..94 1..92 241 47.9 Plus
Dwil\GK10090-PA 131 GK10090-PA 5..129 2..124 158 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17420-PA 230 GE17420-PA 125..230 22..125 482 89.6 Plus
Dyak\GE17420-PA 230 GE17420-PA 1..90 1..88 192 45.6 Plus
Dyak\GE15320-PA 131 GE15320-PA 5..129 2..124 155 32.5 Plus

GM12243.hyp Sequence

Translation from 98 to 475

> GM12243.hyp
MEFNNRLLLKIIELAIAIACIVLYETVGNLSLHPVIVAGTVGGYTVICGV
LLIGHVLNSLVEKRLNALFSLIGCLLFVASGALVIDEWHGGLLNTDRKRQ
AIGAGSLMIINAAVFLLDTLCICRT*

GM12243.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG44325-PE 125 CG44325-PE 1..125 1..125 627 100 Plus
CG44325-PB 125 CG44325-PB 1..125 1..125 627 100 Plus
CG44325-PD 146 CG44325-PD 1..125 1..125 627 100 Plus
CG44325-PC 127 CG44325-PC 1..116 1..114 235 39.7 Plus
CG44325-PA 146 CG44325-PA 1..135 1..114 205 34.1 Plus