Clone GM12693 Report

Search the DGRC for GM12693

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:126
Well:93
Vector:pOT2
Associated Gene/TranscriptCG44242-RA
Protein status:GM12693.pep: gold
Sequenced Size:410

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8446-RD 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

GM12693.complete Sequence

410 bp assembled on 2010-12-02

GenBank Submission: BT125795.1

> GM12693.complete
TAACTTTTACTTTTGCCTTGGCTTTTTGGTAGAAATTCAATTGCTGTTGC
TATGGTTCGACCAACACTAGTTGCGCTGGCTAAGCGCGTACCGCTCATAC
ACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCCCAGACAGCAAACCAG
AAGTTGGCCGGTGGACCAGCAATTGAGGACTATGAGCTGCCGGCACGATT
TGCCCGCAAGCCAATTGATCCCGAAGAGGCGGCTTACATTAATAATGGGG
GTATTCCAAACTGAAGGGGCTCCCAAAGTATGCTGCTTATAAAATATAAC
ACATATTAATGTCACAGCTGTTGTAGACGTCTCGGATTATCACACATGTT
TAGCGTAAATTATACAAGTTCGAATTAAAAAGATGAAAATAAAAAAAAAA
AAAAAAAAAA

GM12693.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12084012..12084250 152..390 1150 98.7 Plus
chr2R 21145070 chr2R 12083742..12083894 1..153 765 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16196690..16196931 152..393 1165 98.8 Plus
2R 25286936 2R 16196420..16196572 1..153 765 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16197889..16198130 152..393 1165 98.7 Plus
2R 25260384 2R 16197619..16197771 1..153 765 100 Plus
Blast to na_te.dros performed on 2019-03-17 01:12:45 has no hits.

GM12693.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:13:29 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12083742..12083894 1..153 100 -> Plus
chr2R 12084014..12084250 154..390 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-12-03 14:28:55 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RD 1..213 52..264 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:38 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RD 1..213 52..264 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:32:33 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RA 1..213 52..264 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:52:03 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RA 1..213 52..264 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-12-03 14:28:55 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RD 20..409 1..390 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:38 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RD 35..424 1..390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:32:33 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RA 37..426 1..390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:52:03 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RA 37..426 1..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:29 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196420..16196572 1..153 100 -> Plus
2R 16196692..16196928 154..390 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:29 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196420..16196572 1..153 100 -> Plus
2R 16196692..16196928 154..390 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:29 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196420..16196572 1..153 100 -> Plus
2R 16196692..16196928 154..390 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:32:33 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12083925..12084077 1..153 100 -> Plus
arm_2R 12084197..12084433 154..390 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:51:51 Download gff for GM12693.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16197891..16198127 154..390 98   Plus
2R 16197619..16197771 1..153 100 -> Plus

GM12693.hyp Sequence

Translation from 51 to 263

> GM12693.hyp
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKLAGGPAIEDYELPARF
ARKPIDPEEAAYINNGGIPN*

GM12693.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-PA 70 CG44242-PA 1..70 1..70 364 100 Plus
CG44242-PB 80 CG44242-PB 1..80 1..70 343 87.5 Plus

GM12693.pep Sequence

Translation from 51 to 263

> GM12693.pep
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKLAGGPAIEDYELPARF
ARKPIDPEEAAYINNGGIPN*

GM12693.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12180-PA 79 GF12180-PA 1..79 1..70 218 65.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20579-PA 80 GG20579-PA 1..80 1..70 331 86.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22779-PA 81 GH22779-PA 1..81 1..70 235 60.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-PA 70 CG44242-PA 1..70 1..70 364 100 Plus
CG44242-PB 80 CG44242-PB 1..80 1..70 343 87.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes14-PA 80 GI20576-PA 1..80 1..70 240 62.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11406-PA 82 GL11406-PA 1..82 1..70 241 70.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24712-PA 82 GA24712-PA 1..82 1..70 241 70.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21670-PA 108 GM21670-PA 73..107 35..69 179 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11171-PA 80 GD11171-PA 1..80 1..70 326 85 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17907-PA 80 GK17907-PA 1..79 1..70 227 65.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11764-PA 80 GE11764-PA 1..80 1..70 336 87.5 Plus