BDGP Sequence Production Resources |
Search the DGRC for GM12693
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 126 |
Well: | 93 |
Vector: | pOT2 |
Associated Gene/Transcript | CG44242-RA |
Protein status: | GM12693.pep: gold |
Sequenced Size: | 410 |
Gene | Date | Evidence |
---|---|---|
CG8446-RD | 2010-11-11 | Gleaning Pick By Joe Carlson |
410 bp assembled on 2010-12-02
GenBank Submission: BT125795.1
> GM12693.complete TAACTTTTACTTTTGCCTTGGCTTTTTGGTAGAAATTCAATTGCTGTTGC TATGGTTCGACCAACACTAGTTGCGCTGGCTAAGCGCGTACCGCTCATAC ACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCCCAGACAGCAAACCAG AAGTTGGCCGGTGGACCAGCAATTGAGGACTATGAGCTGCCGGCACGATT TGCCCGCAAGCCAATTGATCCCGAAGAGGCGGCTTACATTAATAATGGGG GTATTCCAAACTGAAGGGGCTCCCAAAGTATGCTGCTTATAAAATATAAC ACATATTAATGTCACAGCTGTTGTAGACGTCTCGGATTATCACACATGTT TAGCGTAAATTATACAAGTTCGAATTAAAAAGATGAAAATAAAAAAAAAA AAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12083742..12083894 | 1..153 | 100 | -> | Plus |
chr2R | 12084014..12084250 | 154..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8446-RD | 1..213 | 52..264 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8446-RD | 1..213 | 52..264 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG44242-RA | 1..213 | 52..264 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG44242-RA | 1..213 | 52..264 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8446-RD | 20..409 | 1..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8446-RD | 35..424 | 1..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG44242-RA | 37..426 | 1..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG44242-RA | 37..426 | 1..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16196420..16196572 | 1..153 | 100 | -> | Plus |
2R | 16196692..16196928 | 154..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16196420..16196572 | 1..153 | 100 | -> | Plus |
2R | 16196692..16196928 | 154..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16196420..16196572 | 1..153 | 100 | -> | Plus |
2R | 16196692..16196928 | 154..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12083925..12084077 | 1..153 | 100 | -> | Plus |
arm_2R | 12084197..12084433 | 154..390 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16197891..16198127 | 154..390 | 98 | Plus | |
2R | 16197619..16197771 | 1..153 | 100 | -> | Plus |
Translation from 51 to 263
> GM12693.hyp MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKLAGGPAIEDYELPARF ARKPIDPEEAAYINNGGIPN*
Translation from 51 to 263
> GM12693.pep MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKLAGGPAIEDYELPARF ARKPIDPEEAAYINNGGIPN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12180-PA | 79 | GF12180-PA | 1..79 | 1..70 | 218 | 65.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20579-PA | 80 | GG20579-PA | 1..80 | 1..70 | 331 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22779-PA | 81 | GH22779-PA | 1..81 | 1..70 | 235 | 60.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG44242-PA | 70 | CG44242-PA | 1..70 | 1..70 | 364 | 100 | Plus |
CG44242-PB | 80 | CG44242-PB | 1..80 | 1..70 | 343 | 87.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\Tes14-PA | 80 | GI20576-PA | 1..80 | 1..70 | 240 | 62.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11406-PA | 82 | GL11406-PA | 1..82 | 1..70 | 241 | 70.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24712-PA | 82 | GA24712-PA | 1..82 | 1..70 | 241 | 70.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21670-PA | 108 | GM21670-PA | 73..107 | 35..69 | 179 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11171-PA | 80 | GD11171-PA | 1..80 | 1..70 | 326 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17907-PA | 80 | GK17907-PA | 1..79 | 1..70 | 227 | 65.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11764-PA | 80 | GE11764-PA | 1..80 | 1..70 | 336 | 87.5 | Plus |