GM12714.complete Sequence
685 bp assembled on 2009-03-10
GenBank Submission: BT071806.1
> GM12714.complete
AAACTTGTGCATTTAATGAGAAATAAATATAAATAGCCAAAGTAACCGCA
CGTGCCATGCAAATTCGTCGTCCGCGTGGTGTCACTGTTCCGCAATTGAT
GGTGGTCACGGCCATTGGGCTGCTAGGCGGTATTTACATTTGGCAACCGC
TGATTTTGAAGTACAAAAACGAGAAGAAAACCGAGGCAGAAACGCCAGCA
GTAACTGAAACTAGTGGAACCACAAAATGAGTTTCATTAACGGCTTCAAA
AGATTCGCCACAACGACGGTTGGTCTGATGGCCATCGGTATTGGATCGAC
TGTTATATTCTACACCACCCATCGCCTTGTCATCAAACCCTATCTTCTCG
AGAAACGACGCCTGGAAGCCGAGGCCAGTGCGGAGTACCTCTTCCAGCAG
GAGGTTCACTCCCAGATTGGCGAGTCAAGACCCAAACGGAGCGAATATTG
AGCCAAGGCTGCCAGTGCCGTCATAGACATCTTTACATACTTATAGCCTA
GTGATTAGTTACCAAATTTCAACGCTGTAACATGGTGAACAATGAATGGA
CTTTTACTTTCTTACCTTCACTTTGGGTGGAGAGGCCCATCTTCTTGTGT
TCATTTTAGAGTTAAACAGAATGGATTTTTTATGAAAGTAATATGAATTG
AATAAATAATGAAAAGCAAAAAAAAAAAAAAAAAA
GM12714.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:26:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34310-RA | 491 | CG34310-RA | 41..491 | 1..451 | 2255 | 100 | Plus |
cup-RB | 4042 | cup-RB | 3553..3998 | 227..672 | 2215 | 99.7 | Plus |
CG34310-RB | 486 | CG34310-RB | 41..486 | 1..451 | 2155 | 98.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:14:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 6673361..6673801 | 227..667 | 2205 | 100 | Plus |
chr2L | 23010047 | chr2L | 6673063..6673288 | 1..226 | 1130 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:21:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:14:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6674301..6674746 | 227..672 | 2215 | 99.8 | Plus |
2L | 23513712 | 2L | 6674003..6674228 | 1..226 | 1130 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6674301..6674746 | 227..672 | 2215 | 99.7 | Plus |
2L | 23513712 | 2L | 6674003..6674228 | 1..226 | 1130 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-17 00:14:38 has no hits.
GM12714.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:15:26 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 6673063..6673288 | 1..226 | 100 | -> | Plus |
chr2L | 6673361..6673801 | 227..667 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:27 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RB | 1..390 | 57..451 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:02 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RB | 1..390 | 57..451 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:33:51 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RC | 1..225 | 227..451 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:15:57 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RC | 1..225 | 227..451 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-10 16:16:57 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RA | 41..491 | 1..451 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:02 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RA | 41..491 | 1..451 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:33:51 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RA | 40..706 | 1..667 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:15:57 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RA | 40..706 | 1..667 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:26 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6674003..6674228 | 1..226 | 100 | -> | Plus |
2L | 6674301..6674741 | 227..667 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:26 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6674003..6674228 | 1..226 | 100 | -> | Plus |
2L | 6674301..6674741 | 227..667 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:26 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6674003..6674228 | 1..226 | 100 | -> | Plus |
2L | 6674301..6674741 | 227..667 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:33:51 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 6674003..6674228 | 1..226 | 100 | -> | Plus |
arm_2L | 6674301..6674741 | 227..667 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:15 Download gff for
GM12714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6674003..6674228 | 1..226 | 100 | -> | Plus |
2L | 6674301..6674741 | 227..667 | 100 | | Plus |
GM12714.pep Sequence
Translation from 226 to 450
> GM12714.pep
MSFINGFKRFATTTVGLMAIGIGSTVIFYTTHRLVIKPYLLEKRRLEAEA
SAEYLFQQEVHSQIGESRPKRSEY*
GM12714.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34310-PD | 74 | CG34310-PD | 1..74 | 1..74 | 372 | 100 | Plus |
CG34310-PA | 74 | CG34310-PA | 1..74 | 1..74 | 372 | 100 | Plus |
CG34310-PC | 74 | CG34310-PC | 1..74 | 1..74 | 372 | 100 | Plus |
CG34310-PE | 129 | CG34310-PE | 57..129 | 2..74 | 364 | 98.6 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:14:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI17733-PA | 122 | GI17733-PA | 63..118 | 1..59 | 192 | 64.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:14:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14066-PA | 74 | GE14066-PA | 1..74 | 1..74 | 344 | 87.8 | Plus |
GM12714.hyp Sequence
Translation from 226 to 450
> GM12714.hyp
MSFINGFKRFATTTVGLMAIGIGSTVIFYTTHRLVIKPYLLEKRRLEAEA
SAEYLFQQEVHSQIGESRPKRSEY*
GM12714.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:12:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34310-PD | 74 | CG34310-PD | 1..74 | 1..74 | 372 | 100 | Plus |
CG34310-PA | 74 | CG34310-PA | 1..74 | 1..74 | 372 | 100 | Plus |
CG34310-PC | 74 | CG34310-PC | 1..74 | 1..74 | 372 | 100 | Plus |