Clone GM13395 Report

Search the DGRC for GM13395

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:133
Well:95
Vector:pOT2
Associated Gene/TranscriptPrp38-RA
Protein status:GM13395.pep: gold
Preliminary Size:1300
Sequenced Size:1180

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8054 2001-01-01 Release 2 assignment
CG30342 2002-05-16 Blastp of sequenced clone
CG30342 2003-01-01 Sim4 clustering to Release 3
CG30342 2008-04-29 Release 5.5 accounting
CG30342 2008-08-15 Release 5.9 accounting
CG30342 2008-12-18 5.12 accounting

Clone Sequence Records

GM13395.complete Sequence

1180 bp (1180 high quality bases) assembled on 2002-05-16

GenBank Submission: AY118843

> GM13395.complete
CAAACGCCGAAAAATAAATAAATATATTCGGTGCATTTTCACATTTTGCA
CTGCTGCCAATAGATACCCGAATTTCTGGATTGAAAAGTCCTATTTGAGT
TACGATTGACAAGGAACAAGGGTTCAACTGAAAATGGCCAACCGCACGGT
GAAGGAGGCCAAAAACGTGCACGGCACCAATCCGCAGTACCTCATCGAGA
AGATCATCCGTTCGAGGATATACGACTCTAAGTACTGGAAGGAGCAATGC
TTTGCTCTCACTGCGGAGCTTCTGGTGGACAAGGCAATGGAGCTGCGATT
CGTCGGAGGCGTCTACGGCGGCAACATCAAGCCCACCCAGTTCCTCTGCC
TCACACTCAAGATGCTGCAGATTCAGCCGGAAAAGGACATCGTAGTGGAG
TTTATCAAGAACGAGGAGTTCAAGTACGTTCGAGCATTGGGAGCCTTCTA
TCTACGGCTCACAGGAGCTGCCCTGGACTGCTACAAGTACCTGGAGCCGT
TGTACATAGACAATCGAAAGCTGCGCCGCCAGAATCGCGCCGGCCAGTTC
GAGATTGTCTACATGGATGAGTACATTGACGAACTGCTGCGCAACGACCG
TGTCTGCGACATTATACTGCCCCGCATCCAGAAGCGCTCCATTCTCGAGG
AAAACAACGAAATCGAGCCCAAGGTGTCAGTGCTGGATGAGGACTTGGAC
GACGAACTGCCCAGCGACGAGGAGAAGGCAGACGAGACCAACCGGCCTAA
GGAGAATTCGACAGCAGTGAGACGACCACGGAGAGTTCGCTCCAAGTCAA
GGTCCCGCAGTCGGGAGCGCGAGCGAAGATCTGGGCAGGGCAACAGCGCC
CGTTCCCGGGATTACTACGACGAACTGGAAGACTACGACCGCCAGCGAAA
TAGGGTGCGCAATCGGGACACCCACAACGAGGACTATGACCGTCGGCAAA
ACAATGGACGCCACGATCGCGAACGAGAGCGCCAAGATCGCGACAGTATC
AGGGAGCGCGAGAGGGACGGCGACAGAGATCGCCGGGATAGGGAACGAGA
GCGAGAACGTGACCGTGGCCGTCACGACCAGCGGGAACGGGACTCGCGAG
GAGAGCGTGACCGACGACGCTACTAAAATTATAAATAAATTGAATTAATT
AACCAGTAAAAAAAAAAAAAAAAAAAAAAA

GM13395.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Prp38-RA 1193 Prp38-RA 37..1193 1..1157 5785 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5031562..5032718 1..1157 5755 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:22:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9143995..9145156 1..1162 5810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9145194..9146355 1..1162 5810 100 Plus
Blast to na_te.dros performed 2019-03-15 12:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy9 5349 gypsy9 GYPSY9 5349bp 3694..3768 685..753 117 68 Plus

GM13395.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:37:09 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5031562..5032686 1..1129 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:07:45 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
CG30342-RA 1..993 134..1126 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:00 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
Prp38-RA 1..993 134..1126 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:04 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
Prp38-RA 1..993 134..1126 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:37 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
CG30342-RA 1..993 134..1126 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:05:45 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
Prp38-RA 1..993 134..1126 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:33 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
CG30342-RA 37..1193 1..1157 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:00 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
Prp38-RA 37..1193 1..1157 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:04 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
Prp38-RA 40..1196 1..1157 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:38 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
CG30342-RA 37..1193 1..1157 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:05:45 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
Prp38-RA 40..1196 1..1157 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:09 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9143995..9145151 1..1157 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:09 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9143995..9145151 1..1157 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:09 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9143995..9145151 1..1157 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:04 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5031500..5032656 1..1157 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:15:54 Download gff for GM13395.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9145194..9146350 1..1157 100   Plus

GM13395.pep Sequence

Translation from 133 to 1125

> GM13395.pep
MANRTVKEAKNVHGTNPQYLIEKIIRSRIYDSKYWKEQCFALTAELLVDK
AMELRFVGGVYGGNIKPTQFLCLTLKMLQIQPEKDIVVEFIKNEEFKYVR
ALGAFYLRLTGAALDCYKYLEPLYIDNRKLRRQNRAGQFEIVYMDEYIDE
LLRNDRVCDIILPRIQKRSILEENNEIEPKVSVLDEDLDDELPSDEEKAD
ETNRPKENSTAVRRPRRVRSKSRSRSRERERRSGQGNSARSRDYYDELED
YDRQRNRVRNRDTHNEDYDRRQNNGRHDRERERQDRDSIRERERDGDRDR
RDRERERERDRGRHDQRERDSRGERDRRRY*

GM13395.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11961-PA 341 GF11961-PA 1..341 1..330 1142 78.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23421-PA 330 GG23421-PA 1..330 1..330 1345 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22009-PA 350 GH22009-PA 1..350 1..330 1257 74.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Prp38-PA 330 CG30342-PA 1..330 1..330 1722 100 Plus
CG2839-PA 826 CG2839-PA 420..623 127..329 177 27.1 Plus
CG6340-PB 513 CG6340-PB 60..192 193..324 176 32.4 Plus
CG2839-PA 826 CG2839-PA 479..641 166..329 174 28.3 Plus
SF1-PC 323 CG5836-PC 33..133 217..329 172 41.5 Plus
SF1-PB 347 CG5836-PB 33..133 217..329 172 41.5 Plus
SF1-PA 787 CG5836-PA 33..133 217..329 172 41.5 Plus
CG2839-PA 826 CG2839-PA 266..419 166..329 169 25.6 Plus
CG2839-PA 826 CG2839-PA 281..447 163..329 167 26 Plus
CG2839-PA 826 CG2839-PA 320..475 164..329 167 25.3 Plus
CG6227-PA 1224 CG6227-PA 8..149 189..329 167 32 Plus
Caper-PB 594 CG11266-PB 44..158 195..328 166 34.3 Plus
Caper-PA 594 CG11266-PA 44..158 195..328 166 34.3 Plus
CG6686-PB 964 CG6686-PB 26..184 179..329 166 30.7 Plus
SF1-PC 323 CG5836-PC 48..172 195..328 165 35.3 Plus
SF1-PB 347 CG5836-PB 48..172 195..328 165 35.3 Plus
SF1-PA 787 CG5836-PA 48..172 195..328 165 35.3 Plus
CG2839-PA 826 CG2839-PA 302..464 164..329 161 24.1 Plus
CG2839-PA 826 CG2839-PA 356..524 164..329 160 24.7 Plus
CG2839-PA 826 CG2839-PA 473..629 166..329 160 28.9 Plus
CG2839-PA 826 CG2839-PA 364..530 166..329 159 24.6 Plus
CG6686-PA 970 CG6686-PA 26..190 179..329 159 29 Plus
CG7971-PG 1062 CG7971-PG 513..651 189..328 158 34 Plus
CG7971-PA 1062 CG7971-PA 513..651 189..328 158 34 Plus
CG7971-PC 1107 CG7971-PC 513..651 189..328 158 34 Plus
ncm-PA 1330 CG12750-PA 1173..1307 195..329 158 35.5 Plus
CG7971-PF 1655 CG7971-PF 738..876 189..328 158 34 Plus
CG2839-PA 826 CG2839-PA 377..541 166..329 157 26.9 Plus
ncm-PA 1330 CG12750-PA 1179..1329 185..327 157 31.4 Plus
CG2839-PA 826 CG2839-PA 497..657 172..329 156 23 Plus
CG2839-PA 826 CG2839-PA 532..687 172..329 156 22.8 Plus
pea-PA 1242 CG8241-PA 118..263 185..319 156 29.2 Plus
CG2839-PA 826 CG2839-PA 531..671 189..329 155 26.6 Plus
CG2839-PA 826 CG2839-PA 563..725 164..329 155 24.4 Plus
CG6686-PB 964 CG6686-PB 80..238 194..329 154 30.1 Plus
SF1-PC 323 CG5836-PC 1..166 181..328 153 33.5 Plus
SF1-PB 347 CG5836-PB 1..166 181..328 153 33.5 Plus
SF1-PA 787 CG5836-PA 1..166 181..328 153 33.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19715-PA 341 GI19715-PA 1..281 1..273 1155 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17009-PA 347 GL17009-PA 1..347 1..330 1284 79.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15773-PA 347 GA15773-PA 1..347 1..330 1284 79.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21102-PA 330 GM21102-PA 1..330 1..330 1679 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10637-PA 330 GD10637-PA 1..330 1..330 1671 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17512-PA 364 GJ17512-PA 1..290 1..278 1215 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23341-PA 337 GK23341-PA 1..241 1..254 1083 83.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19260-PA 330 GE19260-PA 1..330 1..330 1634 96.1 Plus

GM13395.hyp Sequence

Translation from 133 to 1125

> GM13395.hyp
MANRTVKEAKNVHGTNPQYLIEKIIRSRIYDSKYWKEQCFALTAELLVDK
AMELRFVGGVYGGNIKPTQFLCLTLKMLQIQPEKDIVVEFIKNEEFKYVR
ALGAFYLRLTGAALDCYKYLEPLYIDNRKLRRQNRAGQFEIVYMDEYIDE
LLRNDRVCDIILPRIQKRSILEENNEIEPKVSVLDEDLDDELPSDEEKAD
ETNRPKENSTAVRRPRRVRSKSRSRSRERERRSGQGNSARSRDYYDELED
YDRQRNRVRNRDTHNEDYDRRQNNGRHDRERERQDRDSIRERERDGDRDR
RDRERERERDRGRHDQRERDSRGERDRRRY*

GM13395.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Prp38-PA 330 CG30342-PA 1..330 1..330 1722 100 Plus
CG2839-PA 826 CG2839-PA 420..623 127..329 177 27.1 Plus
CG6340-PB 513 CG6340-PB 60..192 193..324 176 32.4 Plus
CG2839-PA 826 CG2839-PA 479..641 166..329 174 28.3 Plus
SF1-PC 323 CG5836-PC 33..133 217..329 172 41.5 Plus
SF1-PB 347 CG5836-PB 33..133 217..329 172 41.5 Plus
CG2839-PA 826 CG2839-PA 266..419 166..329 169 25.6 Plus
CG2839-PA 826 CG2839-PA 281..447 163..329 167 26 Plus
CG2839-PA 826 CG2839-PA 320..475 164..329 167 25.3 Plus
SF1-PC 323 CG5836-PC 48..172 195..328 165 35.3 Plus
CG2839-PA 826 CG2839-PA 302..464 164..329 161 24.1 Plus
CG2839-PA 826 CG2839-PA 356..524 164..329 160 24.7 Plus
CG2839-PA 826 CG2839-PA 473..629 166..329 160 28.9 Plus
CG2839-PA 826 CG2839-PA 364..530 166..329 159 24.6 Plus
CG2839-PA 826 CG2839-PA 377..541 166..329 157 26.9 Plus
CG2839-PA 826 CG2839-PA 497..657 172..329 156 23 Plus
CG2839-PA 826 CG2839-PA 532..687 172..329 156 22.8 Plus
CG2839-PA 826 CG2839-PA 531..671 189..329 155 26.6 Plus
CG2839-PA 826 CG2839-PA 563..725 164..329 155 24.4 Plus
SF1-PC 323 CG5836-PC 1..166 181..328 153 33.5 Plus