Clone GM13604 Report

Search the DGRC for GM13604

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:136
Well:4
Vector:pOT2
Associated Gene/TranscriptProsalpha2-RA
Protein status:GM13604.pep: gold
Preliminary Size:1300
Sequenced Size:877

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5266 2001-01-01 Release 2 assignment
CG5266 2001-11-29 Blastp of sequenced clone
CG5266 2003-01-01 Sim4 clustering to Release 3
Pros25 2008-04-29 Release 5.5 accounting
Pros25 2008-08-15 Release 5.9 accounting
Pros25 2008-12-18 5.12 accounting

Clone Sequence Records

GM13604.complete Sequence

877 bp (877 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069280

> GM13604.complete
AAATAAGTCGGCTTTTTCATTTTACACATCAAATCACTGCATTTGCGGCC
CAGGAAATATGGCTACCGAACGATACAGCTTTTCGTTGACCACGTTCAGT
CCTTCCGGAAAACTCGTCCAACTGGAGTATGCATTGGCGGCCGTATCTGG
CGGAGCTCCCTCCGTGGGCATTATAGCTTCCAACGGCGTCGTCATTGCCA
CAGAGAACAAACACAAGTCACCGCTGTATGAGCAGCACAGTGTACATCGC
GTGGAGATGATCTACAACCACATCGGCATGGTGTACTCGGGAATGGGTCC
GGACTACCGCCTGCTGGTCAAGCAGGCCCGCAAGATCGCCCAGACGTACT
ACCTGACCTACAAGGAGCCGATTCCAGTGTCACAGCTGGTGCAGCGCGTG
GCCACGCTCATGCAGGAGTACACTCAGTCCGGTGGCGTTCGTCCCTTTGG
CGTTTCCCTACTGATCTGCGGCTGGGACAATGATCGTCCGTATCTCTACC
AATCCGATCCTTCGGGCGCCTACTTCGCCTGGAAGGCCACTGCCATGGGC
AAGAACGCAGTGAACGGCAAAACTTTCCTGGAGAAGCGCTACAGCGAAGA
TCTGGAGCTGGACGACGCTGTTCACACCGCCATCCTTACGCTGAAAGAAG
GTTTTGAGGGAAAAATGACTGCCGACAACATTGAGATCGGAATCTGCGAT
CAGAACGGATTCCAGCGTCTGGACCCCGCCTCAATCAAGGACTACTTGGC
CAGCATCCCCTAAACTTAAACGCCCCGCTAAGATTACCACAAGCTAAGCT
TTCTTAATAAGTACGGGACATTAAAAAACCAATAAAATTTTACAACTGGT
GTTATTTGAAAAAAAAAAAAAAAAAAA

GM13604.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
Pros25-RA 1076 Pros25-RA 144..1002 1..859 4295 100 Plus
Pros25.a 912 Pros25.a 60..912 1..859 4180 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8257674..8257944 588..858 1355 100 Plus
chr3R 27901430 chr3R 8257131..8257389 174..432 1295 100 Plus
chr3R 27901430 chr3R 8257454..8257610 432..588 785 100 Plus
chr3R 27901430 chr3R 8256771..8256869 1..99 495 100 Plus
chr3R 27901430 chr3R 8256969..8257048 97..176 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:22:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12432286..12432557 588..859 1360 100 Plus
3R 32079331 3R 12431743..12432001 174..432 1295 100 Plus
3R 32079331 3R 12432066..12432222 432..588 785 100 Plus
3R 32079331 3R 12431383..12431481 1..99 495 100 Plus
3R 32079331 3R 12431581..12431660 97..176 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12173117..12173388 588..859 1360 100 Plus
3R 31820162 3R 12172574..12172832 174..432 1295 100 Plus
3R 31820162 3R 12172897..12173053 432..588 785 100 Plus
3R 31820162 3R 12172214..12172312 1..99 495 100 Plus
3R 31820162 3R 12172412..12172491 97..176 400 100 Plus
Blast to na_te.dros performed 2019-03-16 16:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
hobo 2959 hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). 2495..2549 800..856 109 68.4 Plus

GM13604.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:16:07 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8257455..8257610 433..588 100 -> Plus
chr3R 8257134..8257389 177..432 100 -> Plus
chr3R 8256771..8256869 1..99 100 -> Plus
chr3R 8256972..8257048 100..176 100 -> Plus
chr3R 8257675..8257944 589..858 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:07:50 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Pros25-RA 1..705 59..763 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:25:34 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Pros25-RA 1..705 59..763 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:33 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 1..705 59..763 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:52:48 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Pros25-RA 1..705 59..763 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:24:14 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 1..705 59..763 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:01:32 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Pros25-RA 59..916 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:25:33 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Pros25-RA 59..916 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:33 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 63..920 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:52:48 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Pros25-RA 59..916 1..858 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:24:14 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 63..920 1..858 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:07 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12431383..12431481 1..99 100 -> Plus
3R 12431584..12431660 100..176 100 -> Plus
3R 12431746..12432001 177..432 100 -> Plus
3R 12432067..12432222 433..588 100 -> Plus
3R 12432287..12432556 589..858 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:07 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12431383..12431481 1..99 100 -> Plus
3R 12431584..12431660 100..176 100 -> Plus
3R 12431746..12432001 177..432 100 -> Plus
3R 12432067..12432222 433..588 100 -> Plus
3R 12432287..12432556 589..858 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:07 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12431383..12431481 1..99 100 -> Plus
3R 12431584..12431660 100..176 100 -> Plus
3R 12431746..12432001 177..432 100 -> Plus
3R 12432067..12432222 433..588 100 -> Plus
3R 12432287..12432556 589..858 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:33 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8257468..8257723 177..432 100 -> Plus
arm_3R 8257789..8257944 433..588 100 -> Plus
arm_3R 8257105..8257203 1..99 100 -> Plus
arm_3R 8257306..8257382 100..176 100 -> Plus
arm_3R 8258009..8258278 589..858 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:28:55 Download gff for GM13604.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12172577..12172832 177..432 100 -> Plus
3R 12172898..12173053 433..588 100 -> Plus
3R 12173118..12173387 589..858 100   Plus
3R 12172214..12172312 1..99 100 -> Plus
3R 12172415..12172491 100..176 100 -> Plus

GM13604.hyp Sequence

Translation from 0 to 762

> GM13604.hyp
NKSAFSFYTSNHCICGPGNMATERYSFSLTTFSPSGKLVQLEYALAAVSG
GAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYNHIGMVYSGMGP
DYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFG
VSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSED
LELDDAVHTAILTLKEGFEGKMTADNIEIGICDQNGFQRLDPASIKDYLA
SIP*

GM13604.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha2-PA 234 CG5266-PA 1..234 20..253 1214 100 Plus
Prosalpha4-PA 249 CG3422-PA 2..234 22..252 368 36.4 Plus
Prosalpha4T2-PB 252 CG4569-PB 3..186 23..205 358 37.5 Plus
Prosalpha4T2-PA 252 CG4569-PA 3..186 23..205 358 37.5 Plus
Prosalpha5-PB 244 CG10938-PB 3..219 20..229 342 33.2 Plus

GM13604.pep Sequence

Translation from 58 to 762

> GM13604.pep
MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATEN
KHKSPLYEQHSVHRVEMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLT
YKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRPYLYQSD
PSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGFE
GKMTADNIEIGICDQNGFQRLDPASIKDYLASIP*

GM13604.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17957-PA 234 GF17957-PA 1..234 1..234 1198 94.4 Plus
Dana\GF19028-PA 249 GF19028-PA 2..231 3..230 398 35.5 Plus
Dana\GF12213-PA 265 GF12213-PA 4..227 5..226 359 39 Plus
Dana\GF11246-PA 252 GF11246-PA 3..191 4..192 354 35.8 Plus
Dana\GF13117-PA 243 GF13117-PA 7..218 5..210 349 33 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18927-PA 234 GG18927-PA 1..234 1..234 1249 98.7 Plus
Dere\GG17945-PA 249 GG17945-PA 2..231 3..230 385 36.9 Plus
Dere\GG15180-PA 251 GG15180-PA 2..181 3..181 363 36.7 Plus
Dere\GG19922-PA 252 GG19922-PA 4..198 5..195 360 36.4 Plus
Dere\GG22074-PA 264 GG22074-PA 4..227 5..226 358 39.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13898-PA 234 GH13898-PA 1..234 1..234 1212 95.3 Plus
Dgri\GH12557-PA 249 GH12557-PA 2..234 3..233 384 35.3 Plus
Dgri\GH21393-PA 245 GH21393-PA 8..219 6..210 366 34.4 Plus
Dgri\GH20521-PA 263 GH20521-PA 4..229 5..230 361 35.5 Plus
Dgri\GH20892-PA 254 GH20892-PA 5..198 6..195 326 35.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha2-PA 234 CG5266-PA 1..234 1..234 1214 100 Plus
Prosalpha4-PA 249 CG3422-PA 2..234 3..233 368 36.4 Plus
Prosalpha4T2-PB 252 CG4569-PB 3..186 4..186 358 37.5 Plus
Prosalpha4T2-PA 252 CG4569-PA 3..186 4..186 358 37.5 Plus
Prosalpha3-PA 264 CG9327-PA 4..231 5..230 343 39.1 Plus
Prosalpha5-PB 244 CG10938-PB 3..219 1..210 342 33.2 Plus
Prosalpha5-PA 244 CG10938-PA 3..219 1..210 342 33.2 Plus
Prosalpha3T-PA 251 CG1736-PA 10..176 11..176 326 43.1 Plus
Prosalpha4T1-PA 249 CG17268-PA 2..199 3..197 321 35.9 Plus
Prosalpha7-PA 253 CG1519-PA 8..193 6..191 286 35.8 Plus
Prosalpha1-PB 244 CG18495-PB 13..240 10..233 285 30.7 Plus
Prosalpha1-PA 244 CG18495-PA 13..240 10..233 285 30.7 Plus
CG30382-PB 244 CG30382-PB 13..240 10..233 285 30.7 Plus
CG30382-PA 244 CG30382-PA 13..240 10..233 285 30.7 Plus
Prosalpha6T-PA 289 CG5648-PA 1..205 1..209 270 30.7 Plus
Prosalpha6-PA 279 CG4904-PA 1..181 1..183 265 32.8 Plus
Prosalpha6-PB 279 CG4904-PB 1..181 1..183 265 32.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24829-PA 234 GI24829-PA 1..234 1..234 1209 94.9 Plus
Dmoj\GI21618-PA 236 GI21618-PA 9..236 3..230 422 36.8 Plus
Dmoj\GI11210-PA 249 GI11210-PA 2..234 3..233 379 34.9 Plus
Dmoj\GI18573-PA 245 GI18573-PA 7..219 5..210 367 33.8 Plus
Dmoj\GI21067-PA 263 GI21067-PA 4..225 5..226 362 36.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27312-PA 234 GL27312-PA 1..234 1..234 1217 96.2 Plus
Dper\GL19724-PA 252 GL19724-PA 3..247 4..232 436 38.4 Plus
Dper\GL20413-PA 252 GL20413-PA 2..235 3..233 403 32.2 Plus
Dper\GL11421-PA 244 GL11421-PA 7..219 5..210 363 33.3 Plus
Dper\GL10139-PA 262 GL10139-PA 4..225 5..226 352 38 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18772-PA 234 GA18772-PA 1..234 1..234 1217 96.2 Plus
Dpse\GA28947-PA 252 GA28947-PA 3..247 4..232 437 38.4 Plus
Dpse\GA25111-PA 252 GA25111-PA 2..235 3..233 403 32.2 Plus
Dpse\GA25292-PA 249 GA25292-PA 2..234 3..233 382 35.7 Plus
Dpse\GA17441-PA 249 GA17441-PA 2..231 3..230 380 35.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24033-PA 234 GM24033-PA 1..234 1..234 1258 100 Plus
Dsec\Pros28.1B-PA 252 GM11825-PA 3..198 4..195 374 37.2 Plus
Dsec\GM15792-PA 264 GM15792-PA 4..227 5..226 359 39.4 Plus
Dsec\GM21770-PA 244 GM21770-PA 7..243 5..233 354 30.4 Plus
Dsec\Pros28.1A-PA 251 GM23164-PA 2..180 3..180 337 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18834-PA 234 GD18834-PA 1..234 1..234 1258 100 Plus
Dsim\Pros28.1B-PA 252 GD24946-PA 3..198 4..195 371 36.7 Plus
Dsim\GD11553-PA 264 GD11553-PA 4..227 5..226 359 39.4 Plus
Dsim\GD11263-PA 244 GD11263-PA 7..243 5..233 347 30 Plus
Dsim\Pros28.1A-PA 251 GD20037-PA 2..180 3..180 339 34.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24473-PA 234 GJ24473-PA 1..234 1..234 1201 94 Plus
Dvir\GJ16557-PA 234 GJ16557-PA 1..233 1..233 544 44.6 Plus
Dvir\Pros28.1-PA 249 GJ18504-PA 2..234 3..233 385 36 Plus
Dvir\GJ20367-PA 245 GJ20367-PA 7..219 5..210 365 34.3 Plus
Dvir\GJ21990-PA 263 GJ21990-PA 4..198 5..195 350 39.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14404-PA 234 GK14404-PA 1..234 1..234 1135 89.7 Plus
Dwil\GK25669-PA 249 GK25669-PA 4..234 5..233 387 37.2 Plus
Dwil\GK19681-PA 255 GK19681-PA 3..198 4..195 366 35.7 Plus
Dwil\GK22956-PA 262 GK22956-PA 4..229 5..230 358 35.5 Plus
Dwil\GK21413-PA 245 GK21413-PA 7..220 5..210 349 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26194-PA 234 GE26194-PA 1..234 1..234 1246 98.7 Plus
Dyak\GE17253-PA 249 GE17253-PA 2..231 3..230 384 36.5 Plus
Dyak\GE11446-PA 252 GE11446-PA 3..182 4..182 370 38.3 Plus
Dyak\GE25043-PA 251 GE25043-PA 2..181 3..181 364 37.2 Plus
Dyak\GE12155-PA 264 GE12155-PA 4..227 5..226 358 39.4 Plus