BDGP Sequence Production Resources |
Search the DGRC for GM13948
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 139 |
Well: | 48 |
Vector: | pOT2 |
Associated Gene/Transcript | RpL13A-RB |
Protein status: | GM13948.pep: gold |
Preliminary Size: | 1300 |
Sequenced Size: | 721 |
Gene | Date | Evidence |
---|---|---|
CG1475 | 2001-01-01 | Release 2 assignment |
CG1475 | 2001-07-04 | Blastp of sequenced clone |
CG1475 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL13A | 2008-04-29 | Release 5.5 accounting |
RpL13A | 2008-08-15 | Release 5.9 accounting |
RpL13A | 2008-12-18 | 5.12 accounting |
721 bp (721 high quality bases) assembled on 2001-07-04
GenBank Submission: AY051640
> GM13948.complete TAAAAATGACTGGTTTAACGAACAGGACCGTTGTTATTGATGGTCGCGGC CATTTGCTCGGTCGCCTGGCCTCCGTGGTGGCCAAGTACCTGTTGCAGGG CGGCAAGGTGGCCGTGGTCCGCTGCGAGGAGCTGAACCTCTCGGGACACT TCTACAGGAACAAGATCAAGTTCCTGGCCTACCTGCGCAAGCGGTGCAAC GTGAACCCAGCCCGTGGTCCATTCCACTTCCGTGCCCCCTCTCGCATCTT CTACAAGGCAGTCCGAGGCATGATCCCACACAAGACCAAGCGTGGCCAGG CCGCCCTCGCCCGTCTGCGTGTGTTCGACGGCATCCCATCGCCCTACGAC AAGCGTCGCCGCGTCGTCGTGCCCATCGCTATGCGTGTGCTGACCCTGCG CTCCGACCGCAAGTACTGCCAGGTGGGTCGCCTGTCGCACGAGGTCGGCT GGCACTACCAGGACGTGATCAAGAGCCTGGAGCGCAAGCGCAAGGCCAAG CTCCGTGTCACCCTCAAGCACAACCGCGAGCTGAAGAAGCTGACGGTCAA GGCGCGCGAGAACATCGCGAAGGCCGCCGAGCCCTTCAACAAAATCATCA AATCCTACGGCTACGAGGTTTAAGGACAACAACAAGGGCAGAATTACATA CGTTCAGATGCGTAGAAGTTTTTTAAAAGAGAATAAAACAACATCTAGTT TAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 1450153..1450178 | 1..26 | 100 | -> | Plus |
chr3R | 1450548..1450788 | 27..267 | 100 | -> | Plus |
chr3R | 1451172..1451605 | 268..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 1..618 | 6..623 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 1..618 | 6..623 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 1..618 | 6..623 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 1..618 | 6..623 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 1..618 | 6..623 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 32..732 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 32..732 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 22..722 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 32..732 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13A-RB | 22..722 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5624890..5625130 | 27..267 | 100 | -> | Plus |
3R | 5624495..5624520 | 1..26 | 100 | -> | Plus |
3R | 5625514..5625947 | 268..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5624890..5625130 | 27..267 | 100 | -> | Plus |
3R | 5624495..5624520 | 1..26 | 100 | -> | Plus |
3R | 5625514..5625947 | 268..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5624890..5625130 | 27..267 | 100 | -> | Plus |
3R | 5624495..5624520 | 1..26 | 100 | -> | Plus |
3R | 5625514..5625947 | 268..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 1450612..1450852 | 27..267 | 100 | -> | Plus |
arm_3R | 1450217..1450242 | 1..26 | 100 | -> | Plus |
arm_3R | 1451236..1451669 | 268..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5365721..5365961 | 27..267 | 100 | -> | Plus |
3R | 5366345..5366778 | 268..701 | 99 | Plus | |
3R | 5365326..5365351 | 1..26 | 100 | -> | Plus |
Translation from 2 to 622
> GM13948.hyp KMTGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHF YRNKIKFLAYLRKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQA ALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVGW HYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIK SYGYEV*
Translation from 5 to 622
> GM13948.pep MTGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFY RNKIKFLAYLRKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAA LARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVGWH YQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIKS YGYEV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16337-PA | 205 | GF16337-PA | 1..205 | 1..205 | 1069 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12958-PA | 205 | GG12958-PA | 1..205 | 1..205 | 1072 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22962-PA | 205 | GH22962-PA | 1..205 | 1..205 | 1057 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL13A-PB | 205 | CG1475-PB | 1..205 | 1..205 | 1058 | 100 | Plus |
RpL13A-PC | 101 | CG1475-PC | 1..88 | 1..88 | 459 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10239-PA | 205 | GI10239-PA | 1..204 | 1..204 | 1056 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24509-PA | 205 | GL24509-PA | 1..205 | 1..205 | 1069 | 99.5 | Plus |
Dper\GL18205-PA | 186 | GL18205-PA | 11..164 | 43..196 | 729 | 90.3 | Plus |
Dper\GL18207-PA | 103 | GL18207-PA | 4..94 | 36..126 | 417 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13222-PA | 205 | GA13222-PA | 1..205 | 1..205 | 1069 | 99.5 | Plus |
Dpse\GA28167-PA | 160 | GA28167-PA | 1..136 | 54..189 | 653 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10821-PA | 205 | GM10821-PA | 1..205 | 1..205 | 1072 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19800-PA | 205 | GD19800-PA | 1..205 | 1..205 | 1072 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11043-PA | 205 | GJ11043-PA | 1..204 | 1..204 | 1051 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13926-PA | 205 | GK13926-PA | 1..205 | 1..205 | 1066 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10144-PA | 205 | GE10144-PA | 1..205 | 1..205 | 1072 | 100 | Plus |