Clone GM13948 Report

Search the DGRC for GM13948

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:139
Well:48
Vector:pOT2
Associated Gene/TranscriptRpL13A-RB
Protein status:GM13948.pep: gold
Preliminary Size:1300
Sequenced Size:721

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1475 2001-01-01 Release 2 assignment
CG1475 2001-07-04 Blastp of sequenced clone
CG1475 2003-01-01 Sim4 clustering to Release 3
RpL13A 2008-04-29 Release 5.5 accounting
RpL13A 2008-08-15 Release 5.9 accounting
RpL13A 2008-12-18 5.12 accounting

Clone Sequence Records

GM13948.complete Sequence

721 bp (721 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051640

> GM13948.complete
TAAAAATGACTGGTTTAACGAACAGGACCGTTGTTATTGATGGTCGCGGC
CATTTGCTCGGTCGCCTGGCCTCCGTGGTGGCCAAGTACCTGTTGCAGGG
CGGCAAGGTGGCCGTGGTCCGCTGCGAGGAGCTGAACCTCTCGGGACACT
TCTACAGGAACAAGATCAAGTTCCTGGCCTACCTGCGCAAGCGGTGCAAC
GTGAACCCAGCCCGTGGTCCATTCCACTTCCGTGCCCCCTCTCGCATCTT
CTACAAGGCAGTCCGAGGCATGATCCCACACAAGACCAAGCGTGGCCAGG
CCGCCCTCGCCCGTCTGCGTGTGTTCGACGGCATCCCATCGCCCTACGAC
AAGCGTCGCCGCGTCGTCGTGCCCATCGCTATGCGTGTGCTGACCCTGCG
CTCCGACCGCAAGTACTGCCAGGTGGGTCGCCTGTCGCACGAGGTCGGCT
GGCACTACCAGGACGTGATCAAGAGCCTGGAGCGCAAGCGCAAGGCCAAG
CTCCGTGTCACCCTCAAGCACAACCGCGAGCTGAAGAAGCTGACGGTCAA
GGCGCGCGAGAACATCGCGAAGGCCGCCGAGCCCTTCAACAAAATCATCA
AATCCTACGGCTACGAGGTTTAAGGACAACAACAAGGGCAGAATTACATA
CGTTCAGATGCGTAGAAGTTTTTTAAAAGAGAATAAAACAACATCTAGTT
TAAAAAAAAAAAAAAAAAAAA

GM13948.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
RpL13A-RB 957 RpL13A-RB 122..832 1..711 3525 99.7 Plus
RpL13A.a 754 RpL13A.a 69..754 26..711 3400 99.7 Plus
RpL13A.b 754 RpL13A.b 66..754 23..711 3400 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1451170..1451605 266..701 2165 99.8 Plus
chr3R 27901430 chr3R 1450547..1450789 26..268 1215 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:22:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5625512..5625957 266..711 2200 99.6 Plus
3R 32079331 3R 5624889..5625131 26..268 1215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5366343..5366788 266..711 2200 99.5 Plus
3R 31820162 3R 5365720..5365962 26..268 1215 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:48:06 has no hits.

GM13948.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:48:50 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1450153..1450178 1..26 100 -> Plus
chr3R 1450548..1450788 27..267 100 -> Plus
chr3R 1451172..1451605 268..701 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:08:09 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 1..618 6..623 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:41:09 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 1..618 6..623 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:41:21 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 1..618 6..623 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:19:27 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 1..618 6..623 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:16:40 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 1..618 6..623 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:47:01 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 32..732 1..701 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:41:09 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 32..732 1..701 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:41:21 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 22..722 1..701 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:19:27 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 32..732 1..701 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:16:40 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13A-RB 22..722 1..701 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:50 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5624890..5625130 27..267 100 -> Plus
3R 5624495..5624520 1..26 100 -> Plus
3R 5625514..5625947 268..701 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:50 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5624890..5625130 27..267 100 -> Plus
3R 5624495..5624520 1..26 100 -> Plus
3R 5625514..5625947 268..701 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:50 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5624890..5625130 27..267 100 -> Plus
3R 5624495..5624520 1..26 100 -> Plus
3R 5625514..5625947 268..701 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:41:21 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1450612..1450852 27..267 100 -> Plus
arm_3R 1450217..1450242 1..26 100 -> Plus
arm_3R 1451236..1451669 268..701 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:54:21 Download gff for GM13948.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5365721..5365961 27..267 100 -> Plus
3R 5366345..5366778 268..701 99   Plus
3R 5365326..5365351 1..26 100 -> Plus

GM13948.hyp Sequence

Translation from 2 to 622

> GM13948.hyp
KMTGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHF
YRNKIKFLAYLRKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQA
ALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVGW
HYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIK
SYGYEV*

GM13948.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
RpL13A-PB 205 CG1475-PB 1..205 2..206 1058 100 Plus
RpL13A-PC 101 CG1475-PC 1..88 2..89 459 100 Plus

GM13948.pep Sequence

Translation from 5 to 622

> GM13948.pep
MTGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFY
RNKIKFLAYLRKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAA
LARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVGWH
YQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIKS
YGYEV*

GM13948.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16337-PA 205 GF16337-PA 1..205 1..205 1069 99.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12958-PA 205 GG12958-PA 1..205 1..205 1072 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22962-PA 205 GH22962-PA 1..205 1..205 1057 98 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
RpL13A-PB 205 CG1475-PB 1..205 1..205 1058 100 Plus
RpL13A-PC 101 CG1475-PC 1..88 1..88 459 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10239-PA 205 GI10239-PA 1..204 1..204 1056 97.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24509-PA 205 GL24509-PA 1..205 1..205 1069 99.5 Plus
Dper\GL18205-PA 186 GL18205-PA 11..164 43..196 729 90.3 Plus
Dper\GL18207-PA 103 GL18207-PA 4..94 36..126 417 86.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13222-PA 205 GA13222-PA 1..205 1..205 1069 99.5 Plus
Dpse\GA28167-PA 160 GA28167-PA 1..136 54..189 653 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10821-PA 205 GM10821-PA 1..205 1..205 1072 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19800-PA 205 GD19800-PA 1..205 1..205 1072 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11043-PA 205 GJ11043-PA 1..204 1..204 1051 98 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13926-PA 205 GK13926-PA 1..205 1..205 1066 98.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10144-PA 205 GE10144-PA 1..205 1..205 1072 100 Plus