Clone GM13959 Report

Search the DGRC for GM13959

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:139
Well:59
Vector:pOT2
Associated Gene/TranscriptIp259-RA
Protein status:GM13959.pep: gold
Preliminary Size:1300
Sequenced Size:907

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5277 2001-01-01 Release 2 assignment
CG5277 2002-05-16 Blastp of sequenced clone
Ip259 2008-04-29 Release 5.5 accounting

Clone Sequence Records

GM13959.complete Sequence

907 bp (907 high quality bases) assembled on 2002-05-16

GenBank Submission: AY118472

> GM13959.complete
AAGCAAGATCTGGTCTACAGAATTAACAATTAACAATGCCGCAGAATGAG
TATATGGAACGCCATCGCAAGCTGTATGGCCGGCGATTGGATTACGAGGA
ACGGAAACGCAAGAAGGAAGCGCGTCTTCCCAAAGACCGAGCACGAAAGG
CTCGCAAGTTGCGCGGCATCAAGGCCAAACTCTTTAATAAGGAGCGACGC
AATGAAAAGATTCAGATTAAGAAGAAGATCCAGGCCCACGAAGAGAAGAA
GGTCAAAAAGCAGGAGGAGAAGGTCGAGGATGGAGCCCTGCCGCATTATC
TGCTCGACAGAGGCATCCAGTCCAGCGCCAAGGTCCTGTCCAATATGATC
AAGCAGAAGCGCAAGGAGAAGGCAGGCAAGTGGGACGTGCCCATTCCCAA
AGTACGCGCTCAGTCAGATGCTGAGGTCTTCAAAGTACTAAAGACCGGAA
AGACAAAGCGAAAGGCATGGAAGCGCATGGTCACAAAAGTCACATTCGTT
GGCGAGAACTTCACACGCAAGCCACCAAAGTTTGAGCGTTTCATTCGACC
GATGGGTCTGCGCATGAAAAAGGCTCACGTTACGCATCCAGAGCTTAAAG
CCACCTTCAATCTGCCCATCATTGGCGTCAAGAAGAACCCCAGCTCGCCC
ATGTTCACTTCCTTGGGTGTAATTACAAAGGGTACTGTGATCGAAGTCAA
CATCTCTGAGCTGGGTTTGGTAACGCAAACGGGAAAAGTTGTCTGGGGCA
AATACGCTCAGGTCACGAACAATCCAGAAAACGATGGTGTTATCAATGCA
GTGCTGCTTGTCTAACCCCGAAAATGTCGCTACCTAATTTAAGAGTTTGA
TTTAATAAACAAACATATACAATAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAA

GM13959.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:49
Subject Length Description Subject Range Query Range Score Percent Strand
Ip259-RA 900 Ip259-RA 28..900 1..873 4245 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10407585..10408452 6..873 4220 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:22:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10408737..10409606 6..875 4230 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10408737..10409606 6..875 4230 99 Plus
Blast to na_te.dros performed 2019-03-15 18:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 4853..4920 195..262 114 68.6 Plus

GM13959.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:09:35 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10407580..10408452 1..873 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:08:10 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 1..780 36..815 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:04 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 1..780 36..815 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:54:14 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 1..780 36..815 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:42 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 1..780 36..815 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:56 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 1..780 36..815 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:38 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 28..900 1..873 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:04 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 28..900 1..873 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:54:14 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 29..901 1..873 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:42 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 28..900 1..873 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:56 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
Ip259-RA 29..901 1..873 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:35 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10408732..10409604 1..873 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:35 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10408732..10409604 1..873 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:35 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10408732..10409604 1..873 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:54:14 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10408732..10409604 1..873 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:15:58 Download gff for GM13959.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10408732..10409604 1..873 98   Plus

GM13959.pep Sequence

Translation from 35 to 814

> GM13959.pep
MPQNEYMERHRKLYGRRLDYEERKRKKEARLPKDRARKARKLRGIKAKLF
NKERRNEKIQIKKKIQAHEEKKVKKQEEKVEDGALPHYLLDRGIQSSAKV
LSNMIKQKRKEKAGKWDVPIPKVRAQSDAEVFKVLKTGKTKRKAWKRMVT
KVTFVGENFTRKPPKFERFIRPMGLRMKKAHVTHPELKATFNLPIIGVKK
NPSSPMFTSLGVITKGTVIEVNISELGLVTQTGKVVWGKYAQVTNNPEND
GVINAVLLV*

GM13959.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15782-PA 259 GF15782-PA 1..259 1..259 1340 99.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10126-PA 259 GG10126-PA 1..259 1..259 1345 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13541-PA 259 GH13541-PA 1..259 1..259 1325 97.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Ip259-PB 259 CG5277-PB 1..259 1..259 1329 100 Plus
Ip259-PA 259 CG5277-PA 1..259 1..259 1329 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10609-PA 259 GI10609-PA 1..259 1..259 1318 97.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18965-PA 259 GL18965-PA 1..259 1..259 1317 96.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18328-PA 259 GM18328-PA 1..259 1..259 1345 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23695-PA 259 GD23695-PA 1..259 1..259 1345 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21832-PA 259 GJ21832-PA 1..259 1..259 1312 96.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19000-PA 259 GK19000-PA 1..259 1..259 1279 95 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Ip259-PA 259 GE18938-PA 1..259 1..259 1345 100 Plus

GM13959.hyp Sequence

Translation from 35 to 814

> GM13959.hyp
MPQNEYMERHRKLYGRRLDYEERKRKKEARLPKDRARKARKLRGIKAKLF
NKERRNEKIQIKKKIQAHEEKKVKKQEEKVEDGALPHYLLDRGIQSSAKV
LSNMIKQKRKEKAGKWDVPIPKVRAQSDAEVFKVLKTGKTKRKAWKRMVT
KVTFVGENFTRKPPKFERFIRPMGLRMKKAHVTHPELKATFNLPIIGVKK
NPSSPMFTSLGVITKGTVIEVNISELGLVTQTGKVVWGKYAQVTNNPEND
GVINAVLLV*

GM13959.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
Ip259-PB 259 CG5277-PB 1..259 1..259 1329 100 Plus
Ip259-PA 259 CG5277-PA 1..259 1..259 1329 100 Plus