Clone GM14140 Report

Search the DGRC for GM14140

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:141
Well:40
Vector:pOT2
Associated Gene/TranscriptCG3262-RF
Protein status:GM14140.pep: gold
Sequenced Size:963

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3262 2010-02-19 Manual selection by Ben Booth

Clone Sequence Records

GM14140.complete Sequence

963 bp assembled on 2009-05-14

GenBank Submission: BT083452.1

> GM14140.complete
CGCGGGGATTGCCTAAAAAGCAACCGATTATTGGAGTGCAAGATATTATA
GTCGTTGCCTCTGGAAAGGGTGGTGTTGGAAAAAGCACCGTGGCAGTTAA
TTTTGCCTGCAGCTTGGCAAAACTAGGAAAGCGAGTAGGATTGCTGGACG
GGGATATCTTCGGGCCTACTATTCCACTTCTCATGAATGTCCATGGCGAG
CCGGTTGTGAACGATAAGAATTTGATGATCCCGCCGCAAAACTACAATGT
AAAGTGCTTGTCTATGGGCATGCTGACACCTGTAGAGACCTCTGTTATCT
GGCGAGGTCCTCTTGTAATGTCAGCAATACAACGACTGCTAAAAGGTACT
GATTGGGGGCTTCTAGATGTCCTAGTTATAGATACTCCACCGGGCACTGG
AGATGTACATCTCTCACTATCCCAGCATGCACCTATCACAGGGGTTATCC
TGGTAACAACACCTCATACTGCAGCTGTTCAGGTGACCTTGAAAGGTGCA
AGCATGTACGAAAAGTTAAATGTTCCTATCTTTGGCGTAGTAGAGAACAT
GAAGTACACCATTTGTCAGAACTGTAATCAACGATTGGAGTTTTTTAAAG
ACAGCCGTATAAGTTCTCTACCGCGCAAGCTAATTTCTCTTCCGTTAGAC
TCACGAATAGCGGATAGCAACGAGAGTGGAGTGCCTGTTGTAATAAAATA
TCCGGACAGCAAGTACTCTTATCTATTTACCCAATTGGCTGAGGAGATTA
CACAAATACTTAACGAACAAAGATGTAATCAAAATCAAAATAACAGTGCA
CATTAAAAAAAATTTGTGTATATCAAAAATTCTTATTACTTACATTTGTT
ATGCTGTACCGCTAAAACCAATAAAGTTATCAGGGGAAAGGGACTGTTGT
TTCGTTTCCCGCATTTACATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

GM14140.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-RD 1192 CG3262-RD 136..1059 1..924 4590 99.7 Plus
CG3262-RC 1176 CG3262-RC 228..1043 109..924 4065 99.8 Plus
CG3262-RC 1176 CG3262-RC 136..231 1..96 465 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22238682..22239509 94..921 4125 99.9 Plus
chr2L 23010047 chr2L 22238539..22238634 1..96 465 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22240151..22240981 94..924 4140 99.9 Plus
2L 23513712 2L 22240008..22240103 1..96 465 99 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22240151..22240981 94..924 4140 99.8 Plus
2L 23513712 2L 22240008..22240103 1..96 465 98.9 Plus
Blast to na_te.dros performed 2019-03-16 12:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 1498..1536 372..334 114 76.9 Minus

GM14140.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:02:47 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22238539..22238634 1..96 98 -> Plus
chr2L 22238685..22239509 97..921 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:53:57 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 77..882 1..806 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:52:31 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 77..882 1..806 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:58:14 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 77..882 1..806 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:34:49 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 77..882 1..806 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-15 08:56:47 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 103..926 1..824 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:52:31 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 103..926 1..824 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:58:14 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 93..1013 1..921 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:34:49 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 93..1013 1..921 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:02:47 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22240008..22240103 1..96 98 -> Plus
2L 22240154..22240978 97..921 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:02:47 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22240008..22240103 1..96 98 -> Plus
2L 22240154..22240978 97..921 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:02:47 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22240008..22240103 1..96 98 -> Plus
2L 22240154..22240978 97..921 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:58:14 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22240008..22240103 1..96 98 -> Plus
arm_2L 22240154..22240978 97..921 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:43:20 Download gff for GM14140.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22240154..22240978 97..921 99   Plus
2L 22240008..22240103 1..96 98 -> Plus

GM14140.pep Sequence

Translation from 2 to 805

> GM14140.pep
RGLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDG
DIFGPTIPLLMNVHGEPVVNDKNLMIPPQNYNVKCLSMGMLTPVETSVIW
RGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVHLSLSQHAPITGVIL
VTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFKD
SRISSLPRKLISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEIT
QILNEQRCNQNQNNSAH*

GM14140.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22737-PA 310 GF22737-PA 3..193 1..191 849 79.1 Plus
Dana\GF10354-PA 261 GF10354-PA 5..257 12..252 358 33.5 Plus
Dana\GF20875-PA 310 GF20875-PA 53..284 12..226 281 38.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21464-PA 294 GG21464-PA 27..292 1..266 1280 89.8 Plus
Dere\GG16127-PA 260 GG16127-PA 5..257 12..252 361 35.2 Plus
Dere\GG22765-PA 311 GG22765-PA 54..285 12..226 276 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13628-PA 292 GH13628-PA 26..290 1..262 1013 72.5 Plus
Dgri\GH14587-PA 264 GH14587-PA 5..254 12..249 355 33.1 Plus
Dgri\GH11560-PA 311 GH11560-PA 54..286 12..226 268 36.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-PE 293 CG3262-PE 27..293 1..267 1378 100 Plus
CG3262-PD 293 CG3262-PD 27..293 1..267 1378 100 Plus
CG3262-PF 207 CG3262-PF 1..207 61..267 1077 100 Plus
CG4858-PA 260 CG4858-PA 5..258 12..253 361 34.3 Plus
CG17904-PA 311 CG17904-PA 54..285 12..226 305 36.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11769-PA 297 GI11769-PA 26..291 1..266 1003 71 Plus
Dmoj\GI13405-PA 264 GI13405-PA 5..254 12..249 340 32.7 Plus
Dmoj\GI17051-PA 310 GI17051-PA 54..285 12..226 255 37.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21144-PA 299 GL21144-PA 33..296 1..263 1081 75 Plus
Dper\GL12799-PA 255 GL12799-PA 5..254 12..252 328 32.3 Plus
Dper\GL18780-PA 311 GL18780-PA 54..285 12..226 272 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17025-PA 299 GA17025-PA 33..296 1..263 1078 75 Plus
Dpse\GA18483-PA 258 GA18483-PA 5..257 12..252 352 33.1 Plus
Dpse\GA14715-PA 311 GA14715-PA 54..285 12..226 269 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18803-PA 293 GM18803-PA 27..293 1..267 1362 96.6 Plus
Dsec\GM22307-PA 260 GM22307-PA 5..258 12..253 357 34.6 Plus
Dsec\GM17199-PA 311 GM17199-PA 54..285 12..226 274 36.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21613-PA 293 GD21613-PA 27..293 1..267 1357 96.3 Plus
Dsim\GD14899-PA 260 GD14899-PA 5..258 12..253 353 34.6 Plus
Dsim\GD24076-PA 311 GD24076-PA 54..285 12..226 263 36.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13135-PA 298 GJ13135-PA 26..294 1..265 1035 72.1 Plus
Dvir\GJ11530-PA 266 GJ11530-PA 5..254 12..249 359 33.1 Plus
Dvir\GJ17301-PA 310 GJ17301-PA 54..285 12..226 263 37.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23989-PA 303 GK23989-PA 34..300 1..267 1075 74.6 Plus
Dwil\GK12055-PA 261 GK12055-PA 5..254 12..249 354 33.1 Plus
Dwil\GK24826-PA 310 GK24826-PA 53..284 12..226 265 37.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12953-PA 293 GE12953-PA 27..293 1..267 1270 89.5 Plus
Dyak\GE19695-PA 260 GE19695-PA 5..258 12..253 364 35 Plus
Dyak\GE23241-PA 260 GE23241-PA 5..258 12..253 362 35 Plus
Dyak\GE12759-PA 311 GE12759-PA 54..285 12..226 269 36.6 Plus

GM14140.hyp Sequence

Translation from 2 to 805

> GM14140.hyp
RGLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDG
DIFGPTIPLLMNVHGEPVVNDKNLMIPPQNYNVKCLSMGMLTPVETSVIW
RGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVHLSLSQHAPITGVIL
VTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFKD
SRISSLPRKLISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEIT
QILNEQRCNQNQNNSAH*

GM14140.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-PE 293 CG3262-PE 27..293 1..267 1378 100 Plus
CG3262-PD 293 CG3262-PD 27..293 1..267 1378 100 Plus
CG3262-PF 207 CG3262-PF 1..207 61..267 1077 100 Plus
CG4858-PA 260 CG4858-PA 5..258 12..253 361 34.3 Plus
CG17904-PA 311 CG17904-PA 54..285 12..226 305 36.6 Plus