Clone GM14157 Report

Search the DGRC for GM14157

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:141
Well:57
Vector:pOT2
Associated Gene/TranscriptCG8860-RA
Protein status:GM14157.pep: gold
Preliminary Size:356
Sequenced Size:374

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8860 2002-01-01 Sim4 clustering to Release 2
CG8860 2002-05-18 Blastp of sequenced clone
CG8860 2003-01-01 Sim4 clustering to Release 3
CG8860 2008-04-29 Release 5.5 accounting
CG8860 2008-08-15 Release 5.9 accounting
CG8860 2008-12-18 5.12 accounting

Clone Sequence Records

GM14157.complete Sequence

374 bp (374 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118846

> GM14157.complete
ATTCAGTTCATTGGTAATTCTTAGTTAAATACTCACAAATCAAAAATGGA
CAAGGTTGTCAAATTCGCCGAACCCGGACGCGCCTTCGCCAAGGACTCAA
TCCGCCTGGTGAAGCGCTGCACAAAACCCGACCGCAAGGAGTTCCAGAAA
ATCGCCATCGCCACCGCCGTGGGCTTCGCCATCATGGGCTTCATCGGCTT
CTTCGTCAAGCTGATTCACATTCCCATTAACAACATCATCGTGGGATCCT
AGAAAGCGGCAGGTGGCCCCCGGACCGGAAAGAGATTACATGTAGTTCAC
GATTCCACGCGCATCTTTAGCGAAATAAATGCCCCTTCTTCGGATTTTAT
ACACACAAAAAAAAAAAAAAAAAA

GM14157.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-RA 405 CG8860-RA 50..405 1..356 1780 100 Plus
Sec61gamma-RA 858 Sec61gamma-RA 187..386 46..245 685 89.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8066698..8067053 356..1 1780 100 Minus
chrX 22417052 chrX 19532679..19532878 46..245 685 89.5 Plus
chr2R 21145070 chr2R 16399545..16399677 244..112 215 77.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12179481..12179838 358..1 1790 100 Minus
X 23542271 X 19643887..19644086 46..245 685 89.5 Plus
2R 25286936 2R 20512745..20512877 244..112 200 76.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12180680..12181037 358..1 1790 100 Minus
X 23527363 X 19651985..19652184 46..245 685 89.5 Plus
Blast to na_te.dros performed 2019-03-16 04:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 3141..3178 218..254 106 78.9 Plus

GM14157.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:59:23 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8066698..8067053 1..356 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:08:25 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 1..207 46..252 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:27 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 1..207 46..252 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:47:46 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 1..207 46..252 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:37:41 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 1..207 46..252 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:56:22 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 1..207 46..252 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:20:48 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 1..356 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:27 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 50..405 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:47:46 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 65..420 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:37:42 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 1..356 1..356 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:56:22 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 65..420 1..356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:59:23 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12179483..12179838 1..356 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:59:23 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12179483..12179838 1..356 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:59:23 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12179483..12179838 1..356 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:47:46 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8066988..8067343 1..356 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:04 Download gff for GM14157.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12180682..12181037 1..356 100   Minus

GM14157.hyp Sequence

Translation from 45 to 251

> GM14157.hyp
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFI
GFFVKLIHIPINNIIVGS*

GM14157.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-PA 68 CG8860-PA 1..68 1..68 343 100 Plus
Sec61gamma-PC 68 CG14214-PC 1..68 1..68 339 98.5 Plus
Sec61gamma-PB 68 CG14214-PB 1..68 1..68 339 98.5 Plus
Sec61gamma-PA 68 CG14214-PA 1..68 1..68 339 98.5 Plus
CG13426-PA 105 CG13426-PA 48..104 10..66 196 64.9 Plus

GM14157.pep Sequence

Translation from 45 to 251

> GM14157.pep
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFI
GFFVKLIHIPINNIIVGS*

GM14157.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20416-PA 68 GF20416-PA 1..68 1..68 334 97.1 Plus
Dana\GF12667-PA 105 GF12667-PA 43..105 5..67 202 60.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22600-PA 68 GG22600-PA 1..68 1..68 341 100 Plus
Dere\GG19242-PA 68 GG19242-PA 1..68 1..68 332 97.1 Plus
Dere\GG20863-PA 105 GG20863-PA 48..104 10..66 199 66.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21072-PA 169 GH21072-PA 54..103 14..63 186 66 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-PA 68 CG8860-PA 1..68 1..68 343 100 Plus
Sec61gamma-PC 68 CG14214-PC 1..68 1..68 339 98.5 Plus
Sec61gamma-PB 68 CG14214-PB 1..68 1..68 339 98.5 Plus
Sec61gamma-PA 68 CG14214-PA 1..68 1..68 339 98.5 Plus
CG13426-PA 105 CG13426-PA 48..104 10..66 196 64.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21533-PA 68 GI21533-PA 1..68 1..68 334 97.1 Plus
Dmoj\GI18672-PA 111 GI18672-PA 57..111 13..67 202 60 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27062-PA 68 GL27062-PA 1..68 1..68 334 97.1 Plus
Dper\GL16814-PA 126 GL16814-PA 69..117 13..61 146 49 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12829-PA 68 GA12829-PA 1..68 1..68 334 97.1 Plus
Dpse\GA24304-PB 105 GA24304-PB 52..96 17..61 143 51.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20379-PA 68 GM20379-PA 1..68 1..68 341 100 Plus
Dsec\GM22977-PA 68 GM22977-PA 1..68 1..68 336 98.5 Plus
Dsec\GM19788-PA 105 GM19788-PA 48..104 10..66 207 68.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15244-PA 68 GD15244-PA 1..68 1..68 341 100 Plus
Dsim\GD25279-PA 105 GD25279-PA 48..104 10..66 209 68.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16006-PA 68 GJ16006-PA 1..68 1..68 334 97.1 Plus
Dvir\GJ21688-PA 107 GJ21688-PA 42..107 2..67 219 59.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16225-PA 68 GK16225-PA 1..68 1..68 334 97.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13468-PA 68 GE13468-PA 1..68 1..68 341 100 Plus
Dyak\GE15861-PA 68 GE15861-PA 1..68 1..68 336 98.5 Plus
Dyak\GE13801-PA 105 GE13801-PA 48..104 10..66 199 63.2 Plus