BDGP Sequence Production Resources |
Search the DGRC for GM14157
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 141 |
Well: | 57 |
Vector: | pOT2 |
Associated Gene/Transcript | CG8860-RA |
Protein status: | GM14157.pep: gold |
Preliminary Size: | 356 |
Sequenced Size: | 374 |
Gene | Date | Evidence |
---|---|---|
CG8860 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8860 | 2002-05-18 | Blastp of sequenced clone |
CG8860 | 2003-01-01 | Sim4 clustering to Release 3 |
CG8860 | 2008-04-29 | Release 5.5 accounting |
CG8860 | 2008-08-15 | Release 5.9 accounting |
CG8860 | 2008-12-18 | 5.12 accounting |
374 bp (374 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118846
> GM14157.complete ATTCAGTTCATTGGTAATTCTTAGTTAAATACTCACAAATCAAAAATGGA CAAGGTTGTCAAATTCGCCGAACCCGGACGCGCCTTCGCCAAGGACTCAA TCCGCCTGGTGAAGCGCTGCACAAAACCCGACCGCAAGGAGTTCCAGAAA ATCGCCATCGCCACCGCCGTGGGCTTCGCCATCATGGGCTTCATCGGCTT CTTCGTCAAGCTGATTCACATTCCCATTAACAACATCATCGTGGGATCCT AGAAAGCGGCAGGTGGCCCCCGGACCGGAAAGAGATTACATGTAGTTCAC GATTCCACGCGCATCTTTAGCGAAATAAATGCCCCTTCTTCGGATTTTAT ACACACAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 8066698..8067053 | 356..1 | 1780 | 100 | Minus |
chrX | 22417052 | chrX | 19532679..19532878 | 46..245 | 685 | 89.5 | Plus |
chr2R | 21145070 | chr2R | 16399545..16399677 | 244..112 | 215 | 77.4 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 12179481..12179838 | 358..1 | 1790 | 100 | Minus |
X | 23542271 | X | 19643887..19644086 | 46..245 | 685 | 89.5 | Plus |
2R | 25286936 | 2R | 20512745..20512877 | 244..112 | 200 | 76.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 3141..3178 | 218..254 | 106 | 78.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 8066698..8067053 | 1..356 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 1..207 | 46..252 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 1..207 | 46..252 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 1..207 | 46..252 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 1..207 | 46..252 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 1..207 | 46..252 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 1..356 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 50..405 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 65..420 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 1..356 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8860-RA | 65..420 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12179483..12179838 | 1..356 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12179483..12179838 | 1..356 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12179483..12179838 | 1..356 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 8066988..8067343 | 1..356 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12180682..12181037 | 1..356 | 100 | Minus |
Translation from 45 to 251
> GM14157.hyp MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFI GFFVKLIHIPINNIIVGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8860-PA | 68 | CG8860-PA | 1..68 | 1..68 | 343 | 100 | Plus |
Sec61gamma-PC | 68 | CG14214-PC | 1..68 | 1..68 | 339 | 98.5 | Plus |
Sec61gamma-PB | 68 | CG14214-PB | 1..68 | 1..68 | 339 | 98.5 | Plus |
Sec61gamma-PA | 68 | CG14214-PA | 1..68 | 1..68 | 339 | 98.5 | Plus |
CG13426-PA | 105 | CG13426-PA | 48..104 | 10..66 | 196 | 64.9 | Plus |
Translation from 45 to 251
> GM14157.pep MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFI GFFVKLIHIPINNIIVGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20416-PA | 68 | GF20416-PA | 1..68 | 1..68 | 334 | 97.1 | Plus |
Dana\GF12667-PA | 105 | GF12667-PA | 43..105 | 5..67 | 202 | 60.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22600-PA | 68 | GG22600-PA | 1..68 | 1..68 | 341 | 100 | Plus |
Dere\GG19242-PA | 68 | GG19242-PA | 1..68 | 1..68 | 332 | 97.1 | Plus |
Dere\GG20863-PA | 105 | GG20863-PA | 48..104 | 10..66 | 199 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21072-PA | 169 | GH21072-PA | 54..103 | 14..63 | 186 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8860-PA | 68 | CG8860-PA | 1..68 | 1..68 | 343 | 100 | Plus |
Sec61gamma-PC | 68 | CG14214-PC | 1..68 | 1..68 | 339 | 98.5 | Plus |
Sec61gamma-PB | 68 | CG14214-PB | 1..68 | 1..68 | 339 | 98.5 | Plus |
Sec61gamma-PA | 68 | CG14214-PA | 1..68 | 1..68 | 339 | 98.5 | Plus |
CG13426-PA | 105 | CG13426-PA | 48..104 | 10..66 | 196 | 64.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21533-PA | 68 | GI21533-PA | 1..68 | 1..68 | 334 | 97.1 | Plus |
Dmoj\GI18672-PA | 111 | GI18672-PA | 57..111 | 13..67 | 202 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27062-PA | 68 | GL27062-PA | 1..68 | 1..68 | 334 | 97.1 | Plus |
Dper\GL16814-PA | 126 | GL16814-PA | 69..117 | 13..61 | 146 | 49 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12829-PA | 68 | GA12829-PA | 1..68 | 1..68 | 334 | 97.1 | Plus |
Dpse\GA24304-PB | 105 | GA24304-PB | 52..96 | 17..61 | 143 | 51.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20379-PA | 68 | GM20379-PA | 1..68 | 1..68 | 341 | 100 | Plus |
Dsec\GM22977-PA | 68 | GM22977-PA | 1..68 | 1..68 | 336 | 98.5 | Plus |
Dsec\GM19788-PA | 105 | GM19788-PA | 48..104 | 10..66 | 207 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15244-PA | 68 | GD15244-PA | 1..68 | 1..68 | 341 | 100 | Plus |
Dsim\GD25279-PA | 105 | GD25279-PA | 48..104 | 10..66 | 209 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16006-PA | 68 | GJ16006-PA | 1..68 | 1..68 | 334 | 97.1 | Plus |
Dvir\GJ21688-PA | 107 | GJ21688-PA | 42..107 | 2..67 | 219 | 59.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16225-PA | 68 | GK16225-PA | 1..68 | 1..68 | 334 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13468-PA | 68 | GE13468-PA | 1..68 | 1..68 | 341 | 100 | Plus |
Dyak\GE15861-PA | 68 | GE15861-PA | 1..68 | 1..68 | 336 | 98.5 | Plus |
Dyak\GE13801-PA | 105 | GE13801-PA | 48..104 | 10..66 | 199 | 63.2 | Plus |