Clone GM14292 Report

Search the DGRC for GM14292

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:142
Well:92
Vector:pOT2
Associated Gene/TranscriptCG11444-RA
Protein status:GM14292.pep: gold
Preliminary Size:1238
Sequenced Size:1067

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11444 2001-01-01 Release 2 assignment
CG11444 2001-10-10 Blastp of sequenced clone
CG11444 2003-01-01 Sim4 clustering to Release 3
CG11444 2008-04-29 Release 5.5 accounting
CG11444 2008-08-15 Release 5.9 accounting
CG11444 2008-12-18 5.12 accounting

Clone Sequence Records

GM14292.complete Sequence

1067 bp (1067 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060986

> GM14292.complete
TGAATAGTGCAAAAAAATTTTTTACAACGTGATTAAATATAGATAATTTT
CGAAACATAAACGGACCGTAAGAATCCGTTAACGTAGCCAGAGTAAAAGC
TCTAGATACAAGCACATCGGACATACAGGAGGAGAGACCTGCGAATACCC
GGGAAACCATAAGGATCAGTCCATAAATCATCATGCCACGAGGAAAGTTC
GTCAACCACAAAGGTCGCAGTCGCCATTTCACATCTCCCGAGGAACTGCA
ACAGGAATCGGAGGAGGATAGCGACCAGACCAGCGGCTCGGGATCAGATA
GCGACGATAAAGACGCTGCCGGCGGCAAAGCCAGTTCCTCTGCGTCCAAA
GCCAAGGCACCCGCCACACGTAAAGCGCCCGTGAATCGCAATCAAAAGTC
TCGATCAGCGGCGGGCGCCGGTGCGGCAAGTTCCTCGGAATCGGAGTCTG
GCGAGGATTCCGACGATGACTCCGAAGCGGAAGCGCGCGATGCCAAGAAG
GGCGTGGCCTCACTCATCGAAATCGAGAATCCCAACCGGGTGACCAAGAA
GGCCACACAAAAGCTATCGGCCATCAAGCTGGACGACGGGCCAGCCGGTG
CCGGCGGTAATCCCAAGCCGGAGCTTTCTCGCCGCGAACGCGAACAGATC
GAAAAGCAGAGAGCGCGCCAGCGTTACGAGAAACTCCATGCTGCTGGTAA
AACCACCGAGGCTAAGGCCGATCTGGCCAGATTGGCTTTGATCCGGCAGC
AGCGCGAGGAGGCGGCCGCCAAGCGGGAGGCGGAAAAGAAGGCAGCCGAT
GTGGGCACCAAAAAGCCGGGTGCCAAGTAGATAATCCATCCCTTTTGAAA
CCTTCCCTTTCCCATGTGGGATTTAATAGAGCTCTCAATCGTGCAACGTA
TACAAAATTCGCAATAATCCTTTTGATGAACAGTGCAATTAGTTAAGCAT
AAATTACCGCAAACATACCTTCAAAATTATGCAAGTTTTCTAAGCCTATC
TTTTGTAACTGCAATTATACATAAATAAACCAACTAATTGTAAAAACAGA
AAAAAAAAAAAAAAAAA

GM14292.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11444-RA 1229 CG11444-RA 182..1229 1..1049 5190 99.8 Plus
CG4438-RA 984 CG4438-RA 633..820 657..844 475 83.5 Plus
CG4438-RA 984 CG4438-RA 231..366 177..312 350 83.8 Plus
CG4438-RA 984 CG4438-RA 485..586 473..574 255 83.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4446016..4447064 1049..1 5245 100 Minus
chr2L 23010047 chr2L 9396100..9396287 844..657 475 83.5 Minus
chr2L 23010047 chr2L 9396554..9396689 312..177 350 83.8 Minus
chr2L 23010047 chr2L 9396334..9396435 574..473 255 83.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4553112..4554164 1054..1 5190 99.7 Minus
2L 23513712 2L 9397163..9397350 844..657 475 83.5 Minus
2L 23513712 2L 9397617..9397752 312..177 350 83.8 Minus
2L 23513712 2L 9397397..9397498 574..473 255 83.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4561210..4562262 1054..1 5200 99.7 Minus
2L 23513712 2L 9397163..9397350 844..657 475 83.5 Minus
2L 23513712 2L 9397617..9397752 312..177 350 83.8 Minus
2L 23513712 2L 9397397..9397498 574..473 255 83.3 Minus
Blast to na_te.dros performed on 2019-03-16 06:16:14 has no hits.

GM14292.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:17:07 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4446016..4447064 1..1049 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:08:34 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 1..648 183..830 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:39:21 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 1..648 183..830 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:26:30 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 1..648 183..830 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:08:07 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 1..648 183..830 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:19:32 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 1..648 183..830 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:20:36 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 182..1229 1..1049 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:39:21 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 182..1229 1..1049 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:26:30 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 34..1081 1..1049 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:08:07 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 182..1229 1..1049 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:19:32 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
CG11444-RA 34..1081 1..1049 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:07 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
X 4553117..4554164 1..1049 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:07 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
X 4553117..4554164 1..1049 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:07 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
X 4553117..4554164 1..1049 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:26:30 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4447150..4448197 1..1049 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:44:21 Download gff for GM14292.complete
Subject Subject Range Query Range Percent Splice Strand
X 4561215..4562262 1..1049 99   Minus

GM14292.pep Sequence

Translation from 182 to 829

> GM14292.pep
MPRGKFVNHKGRSRHFTSPEELQQESEEDSDQTSGSGSDSDDKDAAGGKA
SSSASKAKAPATRKAPVNRNQKSRSAAGAGAASSSESESGEDSDDDSEAE
ARDAKKGVASLIEIENPNRVTKKATQKLSAIKLDDGPAGAGGNPKPELSR
REREQIEKQRARQRYEKLHAAGKTTEAKADLARLALIRQQREEAAAKREA
EKKAADVGTKKPGAK*

GM14292.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21169-PA 210 GF21169-PA 1..210 1..215 492 71.2 Plus
Dana\GF19530-PA 164 GF19530-PA 1..142 1..189 409 53.2 Plus
Dana\GF18397-PA 187 GF18397-PA 1..158 1..190 407 54.7 Plus
Dana\GF21454-PA 196 GF21454-PA 1..137 1..189 167 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18534-PA 215 GG18534-PA 1..215 1..215 737 93 Plus
Dere\GG24029-PA 286 GG24029-PA 91..286 1..215 524 59.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17583-PA 234 GH17583-PA 1..209 1..190 478 61.5 Plus
Dgri\GH11454-PA 228 GH11454-PA 1..196 1..205 365 42.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11444-PB 215 CG11444-PB 1..215 1..215 1066 100 Plus
CG11444-PA 215 CG11444-PA 1..215 1..215 1066 100 Plus
CG4438-PB 189 CG4438-PB 1..189 1..215 573 62.3 Plus
CG4438-PA 189 CG4438-PA 1..189 1..215 573 62.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15182-PA 219 GI15182-PA 1..194 1..190 522 66.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13320-PA 214 GL13320-PA 1..214 1..215 487 75.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11007-PA 214 GA11007-PA 1..214 1..215 487 75.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12684-PA 214 GM12684-PA 1..214 1..215 751 93 Plus
Dsec\GM12473-PA 208 GM12473-PA 18..208 1..215 521 59.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16291-PA 214 GD16291-PA 1..214 1..215 1011 95.8 Plus
Dsim\GD22357-PA 191 GD22357-PA 1..191 1..215 528 60.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17062-PA 225 GJ17062-PA 1..200 1..190 464 63 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17879-PA 208 GK17879-PA 1..185 1..190 515 69.5 Plus
Dwil\GK15029-PA 181 GK15029-PA 1..158 1..190 406 48.9 Plus
Dwil\GK15983-PA 270 GK15983-PA 1..174 1..205 194 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16850-PA 215 GE16850-PA 1..215 1..215 740 94.4 Plus
Dyak\GE10533-PA 196 GE10533-PA 1..196 1..215 567 65.1 Plus

GM14292.hyp Sequence

Translation from 182 to 829

> GM14292.hyp
MPRGKFVNHKGRSRHFTSPEELQQESEEDSDQTSGSGSDSDDKDAAGGKA
SSSASKAKAPATRKAPVNRNQKSRSAAGAGAASSSESESGEDSDDDSEAE
ARDAKKGVASLIEIENPNRVTKKATQKLSAIKLDDGPAGAGGNPKPELSR
REREQIEKQRARQRYEKLHAAGKTTEAKADLARLALIRQQREEAAAKREA
EKKAADVGTKKPGAK*

GM14292.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11444-PB 215 CG11444-PB 1..215 1..215 1066 100 Plus
CG11444-PA 215 CG11444-PA 1..215 1..215 1066 100 Plus
CG4438-PB 189 CG4438-PB 1..189 1..215 573 62.3 Plus
CG4438-PA 189 CG4438-PA 1..189 1..215 573 62.3 Plus