BDGP Sequence Production Resources |
Search the DGRC for GM14307
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 143 |
Well: | 7 |
Vector: | pOT2 |
Associated Gene/Transcript | CG2611-RA |
Protein status: | GM14307.pep: gold |
Preliminary Size: | 1300 |
Sequenced Size: | 669 |
Gene | Date | Evidence |
---|---|---|
CG2611 | 2001-07-04 | Blastp of sequenced clone |
CG2611 | 2003-01-01 | Sim4 clustering to Release 3 |
CG2611 | 2008-04-29 | Release 5.5 accounting |
CG2611 | 2008-08-15 | Release 5.9 accounting |
CG2611 | 2008-12-18 | 5.12 accounting |
669 bp (669 high quality bases) assembled on 2001-07-04
GenBank Submission: AY051645
> GM14307.complete CTCGTGCCGAATTCGGCACGAGGTTTAGTCTGAAATTGGCATCTGGTCAA GATCAACTGCCAGTAGGTAGAGACCACATATGGAGCCCACCAATTCGGAG TCGCGGCACCGCCTAAATGGAGGGGGCAGGAGTTCCGCGCCAGCAGGCTC CGGAGAGTACATCAAGGTGGTGGAGTCCCAATGCGAGACCGATGGATTCG TTAATGAACAGTGGACGGAACCGGCGATGCCAGGTCCAGTGCCTTGGAAG ACCATTATTATCATTCTTTTGCTGTTTATCGGTGGCATTGTTTGCATCGC CTTTGCCACCTTAAACTGGGTGACGGACACGAGCCGGGAGCGATCGGATC GGGTGTGGGCGTTGGGTATCATCGGGGCACTGACCTTCATCCCGGGAAGC TACTATGTGTACGTGCTCTTCTGCATAATGCTCAACCGCAACGGATTCAC CATGGACGAGATACGAAGACTCGGCTAAAAAGGAGAAACCAAAGACACCA AATGTTTCGTCAAATAGAGTTTATTGCTTTTACACTACAGTTATTCACAC ATTTCATTGGCATAATTTCTTTAGCAACAATCTTAATATGTAGTTCATTA TGATACATGTGTATTGCCCCGGTAATTGTATAAAAATATTTTTTAAACAC GAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 20648640..20648906 | 23..289 | 100 | -> | Plus |
chr2L | 20648983..20649344 | 290..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 1..399 | 80..478 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 1..399 | 80..478 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 1..399 | 80..478 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 1..399 | 80..478 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 1..399 | 80..478 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 1..629 | 23..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 1..629 | 23..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 2..634 | 22..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 1..629 | 23..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2611-RA | 2..634 | 22..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20650194..20650460 | 23..289 | 100 | -> | Plus |
2L | 20650537..20650898 | 290..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20650194..20650460 | 23..289 | 100 | -> | Plus |
2L | 20650537..20650898 | 290..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20650194..20650460 | 23..289 | 100 | -> | Plus |
2L | 20650537..20650898 | 290..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 20650194..20650460 | 23..289 | 100 | -> | Plus |
arm_2L | 20650537..20650898 | 290..651 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20650194..20650460 | 23..289 | 100 | -> | Plus |
2L | 20650537..20650898 | 290..651 | 99 | Plus |
Translation from 79 to 477
> GM14307.pep MEPTNSESRHRLNGGGRSSAPAGSGEYIKVVESQCETDGFVNEQWTEPAM PGPVPWKTIIIILLLFIGGIVCIAFATLNWVTDTSRERSDRVWALGIIGA LTFIPGSYYVYVLFCIMLNRNGFTMDEIRRLG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15347-PA | 129 | GF15347-PA | 1..129 | 1..132 | 507 | 74.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21244-PA | 132 | GG21244-PA | 1..132 | 1..132 | 630 | 88.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10874-PA | 127 | GH10874-PA | 1..127 | 1..132 | 366 | 53 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2611-PA | 132 | CG2611-PA | 1..132 | 1..132 | 703 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18248-PA | 126 | GI18248-PA | 1..126 | 1..132 | 399 | 57.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18512-PA | 129 | GL18512-PA | 1..129 | 1..132 | 418 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15400-PA | 129 | GA15400-PA | 1..129 | 1..132 | 462 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23361-PA | 132 | GM23361-PA | 1..132 | 1..132 | 680 | 97.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24272-PA | 132 | GD24272-PA | 1..132 | 1..132 | 689 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22973-PA | 127 | GJ22973-PA | 1..127 | 1..132 | 409 | 57.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15050-PA | 132 | GK15050-PA | 1..132 | 1..132 | 378 | 54.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13318-PA | 132 | GE13318-PA | 1..132 | 1..132 | 597 | 91.7 | Plus |
Translation from 79 to 477
> GM14307.hyp MEPTNSESRHRLNGGGRSSAPAGSGEYIKVVESQCETDGFVNEQWTEPAM PGPVPWKTIIIILLLFIGGIVCIAFATLNWVTDTSRERSDRVWALGIIGA LTFIPGSYYVYVLFCIMLNRNGFTMDEIRRLG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2611-PA | 132 | CG2611-PA | 1..132 | 1..132 | 703 | 100 | Plus |