Clone GM14307 Report

Search the DGRC for GM14307

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:143
Well:7
Vector:pOT2
Associated Gene/TranscriptCG2611-RA
Protein status:GM14307.pep: gold
Preliminary Size:1300
Sequenced Size:669

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2611 2001-07-04 Blastp of sequenced clone
CG2611 2003-01-01 Sim4 clustering to Release 3
CG2611 2008-04-29 Release 5.5 accounting
CG2611 2008-08-15 Release 5.9 accounting
CG2611 2008-12-18 5.12 accounting

Clone Sequence Records

GM14307.complete Sequence

669 bp (669 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051645

> GM14307.complete
CTCGTGCCGAATTCGGCACGAGGTTTAGTCTGAAATTGGCATCTGGTCAA
GATCAACTGCCAGTAGGTAGAGACCACATATGGAGCCCACCAATTCGGAG
TCGCGGCACCGCCTAAATGGAGGGGGCAGGAGTTCCGCGCCAGCAGGCTC
CGGAGAGTACATCAAGGTGGTGGAGTCCCAATGCGAGACCGATGGATTCG
TTAATGAACAGTGGACGGAACCGGCGATGCCAGGTCCAGTGCCTTGGAAG
ACCATTATTATCATTCTTTTGCTGTTTATCGGTGGCATTGTTTGCATCGC
CTTTGCCACCTTAAACTGGGTGACGGACACGAGCCGGGAGCGATCGGATC
GGGTGTGGGCGTTGGGTATCATCGGGGCACTGACCTTCATCCCGGGAAGC
TACTATGTGTACGTGCTCTTCTGCATAATGCTCAACCGCAACGGATTCAC
CATGGACGAGATACGAAGACTCGGCTAAAAAGGAGAAACCAAAGACACCA
AATGTTTCGTCAAATAGAGTTTATTGCTTTTACACTACAGTTATTCACAC
ATTTCATTGGCATAATTTCTTTAGCAACAATCTTAATATGTAGTTCATTA
TGATACATGTGTATTGCCCCGGTAATTGTATAAAAATATTTTTTAAACAC
GAAAAAAAAAAAAAAAAAA

GM14307.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-RA 742 CG2611-RA 71..700 23..652 3135 99.8 Plus
CG2478-RA 4897 CG2478-RA 4749..4897 652..504 745 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20648983..20649344 290..651 1795 99.7 Plus
chr2L 23010047 chr2L 20648640..20648908 23..291 1345 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20650537..20650899 290..652 1800 99.7 Plus
2L 23513712 2L 20650194..20650462 23..291 1345 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20650537..20650899 290..652 1800 99.7 Plus
2L 23513712 2L 20650194..20650462 23..291 1345 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:08:00 has no hits.

GM14307.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:09:05 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20648640..20648906 23..289 100 -> Plus
chr2L 20648983..20649344 290..651 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:08:35 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 1..399 80..478 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:38:43 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 1..399 80..478 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:42:34 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 1..399 80..478 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:30:26 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 1..399 80..478 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:10:35 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 1..399 80..478 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:11:41 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 1..629 23..651 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:38:43 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 1..629 23..651 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:42:34 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 2..634 22..651 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:30:26 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 1..629 23..651 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:10:35 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 2..634 22..651 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:05 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20650194..20650460 23..289 100 -> Plus
2L 20650537..20650898 290..651 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:05 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20650194..20650460 23..289 100 -> Plus
2L 20650537..20650898 290..651 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:05 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20650194..20650460 23..289 100 -> Plus
2L 20650537..20650898 290..651 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:42:34 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20650194..20650460 23..289 100 -> Plus
arm_2L 20650537..20650898 290..651 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:03:02 Download gff for GM14307.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20650194..20650460 23..289 100 -> Plus
2L 20650537..20650898 290..651 99   Plus

GM14307.pep Sequence

Translation from 79 to 477

> GM14307.pep
MEPTNSESRHRLNGGGRSSAPAGSGEYIKVVESQCETDGFVNEQWTEPAM
PGPVPWKTIIIILLLFIGGIVCIAFATLNWVTDTSRERSDRVWALGIIGA
LTFIPGSYYVYVLFCIMLNRNGFTMDEIRRLG*

GM14307.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15347-PA 129 GF15347-PA 1..129 1..132 507 74.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21244-PA 132 GG21244-PA 1..132 1..132 630 88.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10874-PA 127 GH10874-PA 1..127 1..132 366 53 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-PA 132 CG2611-PA 1..132 1..132 703 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18248-PA 126 GI18248-PA 1..126 1..132 399 57.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18512-PA 129 GL18512-PA 1..129 1..132 418 65.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15400-PA 129 GA15400-PA 1..129 1..132 462 65.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23361-PA 132 GM23361-PA 1..132 1..132 680 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24272-PA 132 GD24272-PA 1..132 1..132 689 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22973-PA 127 GJ22973-PA 1..127 1..132 409 57.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15050-PA 132 GK15050-PA 1..132 1..132 378 54.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13318-PA 132 GE13318-PA 1..132 1..132 597 91.7 Plus

GM14307.hyp Sequence

Translation from 79 to 477

> GM14307.hyp
MEPTNSESRHRLNGGGRSSAPAGSGEYIKVVESQCETDGFVNEQWTEPAM
PGPVPWKTIIIILLLFIGGIVCIAFATLNWVTDTSRERSDRVWALGIIGA
LTFIPGSYYVYVLFCIMLNRNGFTMDEIRRLG*

GM14307.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-PA 132 CG2611-PA 1..132 1..132 703 100 Plus