Clone GM14348 Report

Search the DGRC for GM14348

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:143
Well:48
Vector:pOT2
Associated Gene/TranscriptNse1-RA
Protein status:GM14348.pep: gold
Preliminary Size:4600
Sequenced Size:900

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11329 2001-01-01 Release 2 assignment
CG11329 2001-07-04 Blastp of sequenced clone
CG11329 2003-01-01 Sim4 clustering to Release 3
CG11329 2008-04-29 Release 5.5 accounting
CG11329 2008-08-15 Release 5.9 accounting
CG11329 2008-12-18 5.12 accounting

Clone Sequence Records

GM14348.complete Sequence

900 bp (900 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051646

> GM14348.complete
CTTCGGAATCGAATTGTGTATATTTGGATTTGTTTTGAAACATATTCAGT
CATTGGCAATGGAGTTGGTGAAACGCGGGTTCCTGCGTGCGTGCAAGAAC
CACAGCTACCTCAGCTTCGAGCTGATCGATGATATCCTGGCCCCGCTATG
TGCCAACCACAAGACTACAAAGCCCGGCAGCAAGGAGGCGATTAGGGCAC
TGGTGGCGGAGATTAATGACACCATCAGCGACTTGGGCCAGTTGCTGGTC
TTCATCAAGTATCCGGTCAAGGCCGAGGAGTACCTGGTTTACGCCAAGAC
GGACGCTACGCCGGACAGCGTGGCCAACACCGGGCTCACTGCCGAGGAGT
GTCAGTACTTTTCGAAACTGCTGGACAAGATCGCCTCCGAGGAGGACTGC
CACATCGCCTGGAATGACGCCTACAATGATATCGTCCTACAGGCCAGCTC
GAAGCCGTTGAAGAAGAGCCGCATGCAGGAGCTGCTCCAGAAGTGGATCC
AAATGGGCTACTTCATGGAGGTGACCGACAGAATCTACCTAGGTCCACGT
AGCCTCGTCGAGCTCAGTTTCTATTTGAGCTCGAACCACGCCGATAACAT
AAAAAACTGCACGCTGTGCAAGTGCCTGGTGTTGTGGGACATTCGCTGCG
GGTCCTGCAACATCCAGTACCACCGCGGGTGCATCCAAACCTACTTGCAG
AGACGCGATATTTGCCCCTCCTGCGGCAACCTATGGACAACTCCAATAAG
ACGCTCCATTGGTTAATCATTATGTCCGCGACATGTACTATAGATTTTGA
TACTAGAATAACAGTAGTCCGCTTTATTAACTAAATGATTTCAAGGTAGA
AAATAAATAATTTAAAGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM14348.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG11329-RA 878 CG11329-RA 1..870 1..870 4350 100 Plus
cort.a 2037 cort.a 1..236 635..870 1180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6675799..6676666 868..1 4340 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6676737..6677606 870..1 4350 100 Minus
3R 32079331 3R 8043844..8043892 899..851 185 91.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6676737..6677606 870..1 4350 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:18:15 has no hits.

GM14348.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:19:09 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6675799..6676666 1..868 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:08:42 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
CG11329-RA 1..708 59..766 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:45:03 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
CG11329-RA 1..708 59..766 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:35:15 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
CG11329-RA 1..708 59..766 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:13:53 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
CG11329-RA 1..708 59..766 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:00:09 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
Nse1-RA 1..708 59..766 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:28:05 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
CG11329-RA 1..868 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:45:02 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
CG11329-RA 1..868 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:15 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
CG11329-RA 20..887 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:13:53 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
CG11329-RA 1..868 1..868 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:00:09 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
Nse1-RA 20..887 1..868 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:09 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6676739..6677606 1..868 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:09 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6676739..6677606 1..868 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:09 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6676739..6677606 1..868 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:15 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6676739..6677606 1..868 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:50:31 Download gff for GM14348.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6676739..6677606 1..868 100   Minus

GM14348.hyp Sequence

Translation from 0 to 765

> GM14348.hyp
FGIELCIFGFVLKHIQSLAMELVKRGFLRACKNHSYLSFELIDDILAPLC
ANHKTTKPGSKEAIRALVAEINDTISDLGQLLVFIKYPVKAEEYLVYAKT
DATPDSVANTGLTAEECQYFSKLLDKIASEEDCHIAWNDAYNDIVLQASS
KPLKKSRMQELLQKWIQMGYFMEVTDRIYLGPRSLVELSFYLSSNHADNI
KNCTLCKCLVLWDIRCGSCNIQYHRGCIQTYLQRRDICPSCGNLWTTPIR
RSIG*

GM14348.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
Nse1-PB 235 CG11329-PB 1..235 20..254 1253 100 Plus
Nse1-PA 235 CG11329-PA 1..235 20..254 1253 100 Plus

GM14348.pep Sequence

Translation from 58 to 765

> GM14348.pep
MELVKRGFLRACKNHSYLSFELIDDILAPLCANHKTTKPGSKEAIRALVA
EINDTISDLGQLLVFIKYPVKAEEYLVYAKTDATPDSVANTGLTAEECQY
FSKLLDKIASEEDCHIAWNDAYNDIVLQASSKPLKKSRMQELLQKWIQMG
YFMEVTDRIYLGPRSLVELSFYLSSNHADNIKNCTLCKCLVLWDIRCGSC
NIQYHRGCIQTYLQRRDICPSCGNLWTTPIRRSIG*

GM14348.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14456-PA 237 GF14456-PA 1..235 1..235 981 74.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23597-PA 235 GG23597-PA 1..235 1..235 1132 88.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13573-PA 233 GH13573-PA 1..229 1..228 666 53.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Nse1-PB 235 CG11329-PB 1..235 1..235 1253 100 Plus
Nse1-PA 235 CG11329-PA 1..235 1..235 1253 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24117-PA 232 GI24117-PA 1..228 1..228 744 58.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25588-PA 241 GL25588-PA 1..230 1..233 829 66.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10923-PA 241 GA10923-PA 1..230 1..233 831 66.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13979-PA 235 GM13979-PA 1..235 1..235 1191 94.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21390-PA 232 GJ21390-PA 1..228 1..228 746 58.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18896-PA 235 GK18896-PA 3..233 4..233 748 60.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18416-PA 235 GE18416-PA 1..235 1..235 1181 92.3 Plus